(data stored in ACNUC7421 zone)

EMBL: CP000769.PE446

CP000769.PE446       Location/Qualifiers
FT   CDS_pept        507777..508526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4018 HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24666"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7H0"
FT                   /protein_id="ABS24666.1"
FT                   /translation="MGCDESRGRGRGRGRGLIIPHKTGGRIAKVLTPENRAEVLPRFFG
FT                   RSRREAEAVAVSLRPAEVVPTREVVTAFRPAAIRAATVQAALLAPSPESPALRVHPDEP
FT                   TTPVTVAAPRPLPTPPPPRESVERLDAELARVHVTVSRRFLEKLEAATDALGHACPEGN
FT                   AAEILERGLDLILAQHAKRRGLVEKPRKSRGGSRRDTIPAEPSRPAPHGEGGRGGFVSS
FT                   RAVDMYAVSHANFGRPQARENGARRDR"
     gtgggatgtg atgaatcgag aggtcgaggt cggggacggg gtcggggtct gatcatccct        60
     cacaagacgg gcggccggat cgcgaaggtg ctcacccccg agaaccgcgc ggaggtgctg       120
     ccccggttct tcggtcgctc gcgccgcgag gcggaggcgg tcgccgtgtc gctccggccg       180
     gccgaggtgg tgcccacccg cgaggtcgtc accgcgttcc ggccggccgc catccgagcg       240
     gccacggtcc aggccgcgct cctggcaccc tcgcccgagt cgccggcgct tcgagtccac       300
     ccggatgaac cgaccactcc cgtcacggtc gctgccccga ggcccctgcc cactccgccg       360
     ccaccccgcg agtccgtgga gcggctcgac gccgagctcg cccgcgtgca cgtcaccgtc       420
     tcccgccgct tcctcgagaa gctcgaggcc gccacggacg cgctcgggca tgcctgcccg       480
     gaaggcaacg cggcggagat cctcgagcgc ggcctcgacc tcatcctcgc ccagcacgcg       540
     aagcgccgcg gtctcgtcga gaagcctcgg aagagccgcg gagggtcccg ccgcgacacg       600
     atccctgccg agccatcgcg ccctgctcct cacggagaag gcggacgagg tgggttcgtg       660
     agctcgcgtg cggtggacat gtacgcagtg tctcatgcga atttcggccg tccccaggct       720
     cgcgagaacg gcgcgaggcg cgaccgatga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page