(data stored in ACNUC7421 zone)

EMBL: CP000769.PE447

CP000769.PE447       Location/Qualifiers
FT   CDS_pept        complement(509085..510455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0452"
FT                   /product="MOFRL domain protein"
FT                   /note="PFAM: MOFRL domain protein; KEGG: ade:Adeh_3968
FT                   MOFRL"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24667"
FT                   /db_xref="GOA:A7H7H1"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7H1"
FT                   /protein_id="ABS24667.1"
FT                   /translation="MRCSPLGPASPGTGDSIACPSHRNDAAAREVTMQARRPLASTCED
FT                   IYRAALHRLDAARRVAAELASSPLPPGPVRVLALGKAATPMIEAALAALGDRARHPLCV
FT                   HPEGTRPPAGARAIAAGHPRPTRGSLAAGEAIRAWADANGGATALVLLSGGGSALAVAP
FT                   AAGLSLEEKADALAAVMRAGATIQELNAVRKHLSDLKGGRLGARLAPAPVRVLVLSDVP
FT                   GDDLSTIASGPLVPDPTTWADVGAVLDRTRTRGALPAAVRAFVEAESAAGRETPKPGDP
FT                   RFATIAHRLLAGPTELARAAAEAAAERGISAEADPAPLTGDVAAVAARLGAWARANAGR
FT                   GPRLLALGGEPTISVPAAAHPDGGRAQALALLAAKELAGLPAAALAAGSDGRDGPTEHA
FT                   GAVVDGETAPGAAAAGVDLDAALAEARSGPACAALGVAIPRFETGTHVCDLVLVAVE"
     atgcgatgct cccctctcgg cccggcgtcg ccggggacag gcgattctat cgcttgcccc        60
     tcgcaccgca acgacgctgc cgcacgggag gtgacgatgc aagcccgacg cccactcgcg       120
     tccacctgtg aggacatcta ccgcgcagcc ctccatcggc tcgacgcggc ccgacgcgtc       180
     gcggcggagc tcgcgagctc cccgctgccg ccgggcccgg tgcgcgtgct ggcgctcggg       240
     aaagctgcta ccccaatgat cgaggcggcc ctcgccgcgc tcggcgaccg cgcgcggcac       300
     ccgctctgcg tccacccgga gggaacgcgc ccccccgcgg gcgcgcgtgc catcgcggcg       360
     ggccacccgc ggccgacgcg cggctcgctc gcggcgggcg aggcgatccg cgcctgggcc       420
     gacgcgaacg ggggtgcgac ggcgctcgtc ctgctctccg gcggcggcag cgcgctggcg       480
     gtggcgcccg cggcggggct ctccctcgag gagaaggccg acgcgctcgc cgccgtcatg       540
     cgggcaggcg cgaccatcca ggagctgaac gccgtccgca agcacctgtc cgacctgaag       600
     ggcggccgcc tcggggcccg gctcgcgccc gcgccggtgc gggtcctcgt cctctccgac       660
     gtccccggcg acgacctctc caccatcgcc tcgggtccgc tcgtgcccga ccccaccacc       720
     tgggcggacg tgggcgcggt cctcgaccgc acccgcacgc gcggggcgct gccggcggcg       780
     gtccgcgcct tcgtcgaggc ggagtcggcg gcgggccgcg agacgccgaa gccgggcgac       840
     cctcgcttcg ccacgatcgc gcaccgcctc ctcgccgggc ctaccgagct cgcgcgcgcc       900
     gccgccgagg ccgccgccga gcggggcatc tccgccgagg cggatcccgc gccgctcacc       960
     ggcgacgtcg ccgcggtcgc ggcgcgcctc ggcgcgtggg cgcgcgcgaa cgccggccgc      1020
     ggcccgcggc tgctcgccct cggcggagag cccaccatca gcgtcccggc cgccgcccac      1080
     cccgacggcg gccgcgcgca ggcgctcgcg ctcctcgccg cgaaggagct cgcggggctc      1140
     cccgccgccg cgctcgccgc cggctccgac ggccgcgacg gcccgacgga gcacgccggc      1200
     gccgtcgtgg acggcgagac cgctcccggg gctgccgccg ccggcgtcga cctcgatgcc      1260
     gcgctcgccg aggcgcgctc gggcccggcc tgcgcggcgc tcggggtcgc catcccgcgc      1320
     ttcgagaccg ggacgcacgt gtgcgatctg gtgctggtgg cggtggagta g               1371
//

If you have problems or comments...

PBIL Back to PBIL home page