(data stored in ACNUC7421 zone)

EMBL: CP000769.PE448

CP000769.PE448       Location/Qualifiers
FT   CDS_pept        510553..511101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0453"
FT                   /product="histidine kinase HAMP region domain protein"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   KEGG: ade:Adeh_3967 HAMP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24668"
FT                   /db_xref="GOA:A7H7H2"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7H2"
FT                   /protein_id="ABS24668.1"
FT                   /translation="MAGAGLAVALVFGLWLHQAHVQATALLASDPETRALVARSDRVLL
FT                   GAFGAIALLLAGALGLLGVVVTHRVAGPVFVMGHYVRVLSEGRFPRMRTLRRSDELKPF
FT                   FRTFIQAVEAMKAREARHAAVLSDALQRMCAASARSPELAPAIEALTAALAERHSALAL
FT                   DDSEPTPIAVPAPQRRALP"
     atggcgggcg ccgggctggc cgttgcgctc gtgttcggcc tgtggctcca ccaggcgcac        60
     gtccaggcga cggcgctgct cgcgtcggac cccgagacgc gcgccctcgt ggcccgcagc       120
     gatcgcgtcc tgctcggcgc gttcggcgcg atcgcgctgc tcctcgccgg cgcgctcggg       180
     ctcctcggcg tggtcgtcac ccaccgcgtc gccggccccg tgttcgtcat gggccactac       240
     gtgcgcgtgc tctccgaggg gcgcttcccg cgcatgcgga cgctgcgcag gagcgacgag       300
     ctcaagccct tcttccgcac gttcatccag gcggtcgagg cgatgaaggc acgcgaggcg       360
     cgccacgcgg cggtgctctc cgacgcgctg cagcgcatgt gcgccgcctc cgcgcgctcg       420
     ccggagctcg cccccgccat cgaggcgctg accgccgccc tcgccgaacg ccacagcgcc       480
     ctcgcgctcg acgactccga gccgacgccc atcgccgtcc ccgcgccgca gcggcgcgcc       540
     ctgccgtaa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page