(data stored in ACNUC7421 zone)

EMBL: CP000769.PE450

CP000769.PE450       Location/Qualifiers
FT   CDS_pept        complement(512725..514188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3965 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24670"
FT                   /db_xref="InterPro:IPR011685"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7H4"
FT                   /protein_id="ABS24670.1"
FT                   /translation="MGERPRPSPLCARTGERGPCQARYTRRPGRPVPRRLSDRRWLEQL
FT                   LDEELLGHDPHQARARLPADVRAAASTPLDLAPAANLLVARSLRRRVAVRVPGEGADRP
FT                   ASARDVFLDEVRAHIGLALDLALLRGDPFVRARRRAEIAAALAAAAGEHALAIEAEPEQ
FT                   PGGASDRAVERAVRGAAEALHARFYPPAEPAHALPLHAGKVAVLRRRLARVVSGYHRDG
FT                   RLVGAALARHGAYAARETLLLVEALAGLLGAAGDGDGAAVRVLRQRQIARLGLGRADAR
FT                   EARRAIVAPRDPEAIADAAPERVRGFLLEQLRLAQLGLKLVEEEPAAWVERFVRAAGLD
FT                   AQAIASAEIEAAAQHADHADWLEALGDGPRAWQGLASDLDVATDEVVERVTVAVTDNLE
FT                   ALVTEIRETGELGQLLARAASGGALSRDEKKKVKAQLIDLAKAVPALAIFAAPGGMLLL
FT                   PLLAKLLPFNLLPSAWEKPAESKRKQVAR"
     ttgggcgaac gcccccgccc ctcccccctt tgcgcccgga cgggcgagcg cggcccctgc        60
     caggcacgct acactcgccg ccccggacgc cccgtgccga gacggctcag cgacagacgc       120
     tggctcgagc agctcctgga cgaggagctg ctcggccacg atccccacca ggcccgcgcg       180
     cggcttcccg ccgacgtgcg tgccgcggca tccactcccc tcgatctcgc gccggcggcg       240
     aacctgctcg tggcccgctc gctgcgccgg cgggtcgcgg tgcgcgttcc gggcgagggg       300
     gcggatcgcc cggcctctgc gcgagacgtg ttcctcgacg aggtccgcgc gcacatcggt       360
     ctcgcgctcg acctcgccct gctgcgcggc gatccgttcg tgcgggcccg gcgccgtgct       420
     gagatcgccg ccgcgctggc cgctgccgcc ggcgagcacg ccctggcgat cgaggcggag       480
     ccggagcagc cgggcggcgc cagcgaccgg gccgtggagc gggcggtgcg cggcgcggcc       540
     gaggcgctcc acgcgcggtt ctatccgccc gccgagccgg ctcacgcgct gccgctccac       600
     gccggcaagg tcgcggtgct ccgccgccgc ctcgcgcgcg tggtgagcgg gtaccaccgc       660
     gacggccgcc tcgtgggcgc cgcgctggcg cgccacggcg cctacgccgc ccgcgagacc       720
     ctgctcctcg tcgaggcgct cgccgggctc ctcggcgccg ccggcgacgg cgacggcgcg       780
     gcggtccgcg tcctgcgcca gcggcagatc gcgaggctcg ggctgggccg cgccgatgcg       840
     cgcgaggcgc gccgcgccat cgtcgcgccc cgcgaccccg aggcgatcgc ggacgcggcg       900
     ccggagcgcg tgcgcgggtt cctcctcgag cagctccggc tcgcgcagct cggcctcaag       960
     ctcgtggagg aggagcccgc ggcgtgggtc gagcggttcg tgcgggcggc agggctcgac      1020
     gcccaggcca tcgccagcgc ggagatcgag gcggcggcgc agcacgcgga ccacgcggac      1080
     tggctggagg cgctcggcga cggcccccgc gcctggcagg gcctcgcgtc ggacctcgac      1140
     gtcgccacgg acgaggtcgt cgagcgggtg acggtggcgg tgaccgacaa cctcgaggcg      1200
     ctcgtcaccg agatccgcga gaccggcgag ctcggacagc tcctcgcccg ggcggcgtcg      1260
     ggcggcgcgc tctcgcgcga cgagaagaag aaggtgaagg cgcagctcat cgatctcgcg      1320
     aaggcggtgc cggcgctcgc gatcttcgcc gcgcccggcg ggatgctgct cctcccgctc      1380
     ctcgcgaagc tgctgccgtt caacctcctc ccgagcgcgt gggagaagcc cgccgagtcg      1440
     aagcggaagc aggtcgcgag gtag                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page