(data stored in ACNUC7421 zone)

EMBL: CP000769.PE452

CP000769.PE452       Location/Qualifiers
FT   CDS_pept        complement(515668..516267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0457"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   ade:Adeh_3962 protein of unknown function DUF179"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24672"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H7H6"
FT                   /protein_id="ABS24672.1"
FT                   /translation="MPSPAPSGLAPGFLVAAPALGDPNFAGSLVLMAEHHGEGALGFVV
FT                   NRPGPVTVAEVLASVDEDLRRAAEANGRAGAPVLVGGPVQPERLWILFRPGGIGADAEG
FT                   AVPVGNGLSLGGSRELLEALVRAPRGDPFLLLLGYAGWAPMQVEREVAAGAWVPLELEG
FT                   SDLVFDVPLEQRWETAVRRLGLEPGGFLVGGGGASA"
     atgccgagcc ccgcgccctc cggcctcgcc cccggcttcc tcgtcgcagc gcccgccctg        60
     ggcgacccga acttcgccgg ctcgctcgtg ctcatggccg agcaccacgg cgagggcgcg       120
     ctggggttcg tggtgaaccg cccaggcccg gtcacggtcg cggaggtgct cgcgagcgtg       180
     gacgaggatc tccgccgcgc cgcggaggcg aacgggcgcg ccggcgcgcc ggtgctggtg       240
     ggcgggccgg tccagcccga gcgcctctgg atcctcttcc gcccgggcgg catcggcgcg       300
     gacgcggagg gagcggtgcc cgtcggcaac ggcctgtccc tgggaggttc gcgcgagctg       360
     ctcgaggccc tggtgcgcgc gccgcgcggc gacccgttcc tgctcctcct cggctacgcg       420
     ggctgggcgc cgatgcaggt cgagcgggag gtggccgccg gcgcgtgggt gccgctcgag       480
     ctcgagggca gcgatctcgt gttcgacgtg ccgctcgagc agcgctggga gacggcggtc       540
     cgccggctgg gcttggagcc gggcggtttc ctggtaggcg gcggcggcgc gtctgcctga       600
//

If you have problems or comments...

PBIL Back to PBIL home page