(data stored in ACNUC7421 zone)

EMBL: CP000769.PE453

CP000769.PE453       Location/Qualifiers
FT   CDS_pept        complement(516388..516981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0458"
FT                   /product="putative cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: ade:Adeh_1457 DNA-binding cold-shock
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24673"
FT                   /db_xref="GOA:A7H7H7"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7H7"
FT                   /protein_id="ABS24673.1"
FT                   /translation="MQKPIEIGWRNVAPSPAVSALIRDEAARLERASDRIVGCSVKLEA
FT                   PSRHHRHSGSQYRVRVEVSVPRGKIVVGRNPPRTDTHADLYAVVKQAFREARRQLEDRV
FT                   RRIDGRVKSHAPPAEEAVVARLLPEESYGFLRTADGRDVYFHANAVLRGLFSRLRVGRA
FT                   VRFVETRGDEGPQASTVDPLPARRRATPAPAPAR"
     atgcagaagc ccatcgagat cggctggagg aacgtggcgc cctcgcccgc ggtgtcggcg        60
     ctcatccgcg acgaggcggc gcgcctggag cgcgcgtcgg accggatcgt cgggtgctcg       120
     gtgaagctgg aggcgcccag ccgccaccac cggcacagcg gctcgcagta ccgcgtccgc       180
     gtggaggtct cggtgccgcg cggcaagatc gtggtcgggc gcaacccgcc gcggaccgat       240
     acccacgccg atctctacgc cgtcgtgaag caggcgttcc gcgaggcgcg ccggcagctc       300
     gaggaccgcg tgcggcgcat cgacggccgc gtgaagtccc acgcgccgcc ggcggaggag       360
     gcggtggtgg cccgcctcct ccccgaggag agctacgggt tcctccgcac ggcggacggg       420
     cgagacgtgt acttccacgc gaacgccgtg ctgcgcgggc tcttctcgcg gctccgcgtc       480
     ggccgggcgg tccgcttcgt cgagacgcgc ggcgacgagg gaccgcaggc gagcacggtg       540
     gatccgctcc cggcgcgccg gcgggcgacg cccgcccccg cgccggcgcg ctga             594
//

If you have problems or comments...

PBIL Back to PBIL home page