(data stored in ACNUC7421 zone)

EMBL: CP000769.PE462

CP000769.PE462       Location/Qualifiers
FT   CDS_pept        528431..528805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0467"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   mxa:MXAN_2684 response regulator CheY4"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24682"
FT                   /db_xref="GOA:A7H7I6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7I6"
FT                   /protein_id="ABS24682.1"
FT                   /translation="MKVLLVDDTRTLLSLIQVYLMGWQIEFVEAKDGTEGLARAREHRP
FT                   DLVITDVRMPGMDGFELCAAIRADTVLHKTPIVLLTSLADDASRKKGKLVGATAFLTKP
FT                   VSVEELRNTVGGILRLPARR"
     atgaaggtgc tgctcgtgga cgatacccgg acgctgctgt cgctcatcca ggtctacctg        60
     atgggctggc agatcgagtt cgtggaggcg aaggacggca cggaggggct cgcgcgggcg       120
     cgcgagcacc gtccggacct cgtcatcacg gacgtgcgga tgcccggcat ggacggcttc       180
     gagctgtgcg cggccatccg cgcggacacc gtcctgcaca agacccccat cgtcctcctc       240
     acctcgctcg cggacgacgc gagccgcaag aagggcaagc tcgtcggcgc gaccgcgttc       300
     ctcaccaagc ccgtgtcggt cgaggagctc cggaacaccg tgggcggcat cttgcggctc       360
     ccggcgagga ggtag                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page