(data stored in ACNUC7421 zone)

EMBL: CP000769.PE463

CP000769.PE463       Location/Qualifiers
FT   CDS_pept        528807..529367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0468"
FT                   /product="putative CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: mxa:MXAN_2685
FT                   chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24683"
FT                   /db_xref="GOA:A7H7I7"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7I7"
FT                   /protein_id="ABS24683.1"
FT                   /translation="MALGSRDTREPAPRAPADPRAGLDVAPSPEERRRVLDERARAIAP
FT                   ARETAAVATLPVVAFALGGERYGIPVEDVFQILDAGTLSPLPAVPAWLVGAAVSRGRIV
FT                   PVVDLRQLLGLDGGGMSDLAKIVVVEHGADAFGLAAEVVEGQLELPRAGLSPVTAGPFA
FT                   WIAPDRLAVLDLGKLAAPAALGG"
     gtggcgctcg ggtcgcgaga cacgcgggag cccgcgccgc gcgcgccggc cgacccccgg        60
     gccgggctcg acgtggcgcc gtcgcccgag gagcgccggc gcgtgctcga cgagcgggcg       120
     cgcgccatcg cgccagcgcg cgagacggcc gccgtcgcca cgctgccggt ggtcgccttc       180
     gcgctcggag gcgagcgcta cgggatcccg gtggaggacg tcttccagat cctcgacgcg       240
     gggacgctct ccccgctccc ggccgtgccg gcctggctgg tcggcgccgc ggtctcccgc       300
     ggccgcatcg tgccggtcgt cgatctgcgg cagctcctgg ggctcgacgg cggcggcatg       360
     agcgacctcg cgaagatcgt ggtggtcgag catggcgcgg acgccttcgg gctcgcggcg       420
     gaggtcgtcg aggggcagct ggagctcccg cgcgccgggc tctccccggt gaccgccggg       480
     ccgttcgcct ggatcgcgcc cgaccggctc gcggtcctcg acctcggcaa gctggccgcc       540
     ccggcggcgc tgggcggata g                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page