(data stored in ACNUC7421 zone)

EMBL: CP000769.PE464

CP000769.PE464       Location/Qualifiers
FT   CDS_pept        529371..531863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0469"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; CheW domain
FT                   protein; ATP-binding region ATPase domain protein; Hpt
FT                   domain protein; KEGG: mxa:MXAN_2686 sensor histidine
FT                   kinase/response regulator CheA4"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24684"
FT                   /db_xref="GOA:A7H7I8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7I8"
FT                   /protein_id="ABS24684.1"
FT                   /translation="MDRELFRQIWPVFSAEAREHLEGISAGILELERDPGRPVIDGVRR
FT                   IAHSLKGSAGSLGLADLERLAHALEGSLAGYDPAAGLSRAAVQAALEAVEAMEAALASG
FT                   DAGGVVEVPAVDALLVGLGAAARIGQGPGTAARDEATLGPTGAAAASADVLAGMDALEA
FT                   ALEQLCAPLEPDARRAVAGGAARGALHLAALAAPGVAALARRAADAFTLLAEGGPDAPR
FT                   ATAALAGDLIDLREALARAPVAPAPAEAGPTGAAAAAKARGERSIRVLASTLDSIGRQF
FT                   ELLALAEARRARRARDVLGHAEAVRGALQSLDHATRRLRGAGIETGRAELDSASTRLRE
FT                   VAAALGRVALEAQREAEAQRLAGTVLREDLRGLRMVPAALVLEPLRRAVRDVAGRLGKE
FT                   VELTVEGGEVRLDRQIVDALRDPLLHLVRNAVDHGIEAPAARRDAGKPTGGRIAVRVEP
FT                   RGARVAIVVEDDGPGLDVGAIRAAAVRKGLLTTEEVDRLTDAEAARLVFHAGVSTARAV
FT                   TEISGRGVGMDVVLETLARLQGTIDVRWEAGRGTRFDLDVPLALSASAALVVRVGRDVV
FT                   AVSADPIEHVVLLRDQDLGTVAGRTTVLVAGEHVPYAPLARLLRSEEGGGPARQAVALV
FT                   LAHGGARVAVGVDELVGQQELVISSLGGLVAQIAHLAGAAVLDDGRVVGVLSAPELLRR
FT                   AQPGAAAARAREGGRRVLVADDSLTTRSAMKALLELAGYAVLPAADGEEALQLLREAGA
FT                   DLVVSDVQMPRLDGFGLARKVKADPRLRRTPVILVTSLDAPEDRATGLAAGADGYLVKR
FT                   EVERGKLLDLVRQLLPRA"
     atggatcgcg agctcttccg gcagatctgg cccgtcttct ccgccgaggc gcgcgagcac        60
     ctcgagggga taagcgcggg catcctcgag ctcgagcgcg atccgggccg ccccgtgatc       120
     gacggcgtgc gccgcatcgc gcacagcctc aagggctcgg cgggcagcct cggcctcgcc       180
     gacctcgagc ggctcgcgca cgcgctggag ggatcgctcg cgggctacga ccccgccgcc       240
     gggctctcgc gcgcggccgt gcaggccgcg ctcgaggccg tcgaggcgat ggaggcggct       300
     ctcgcctcgg gcgatgcggg aggcgtcgtc gaggtgccgg cggtggacgc gctcctcgtc       360
     gggctcggcg cggccgctcg gatcggccag ggccccggca ccgccgcgcg cgacgaggcg       420
     acccttgggc cgacgggcgc ggccgccgcc tccgccgacg tgctcgccgg catggacgcg       480
     ctcgaggcgg cgctcgagca gctctgcgcg cccctcgagc ccgacgctcg ccgggcggtc       540
     gccggcggcg ccgcgcgtgg cgcgctccac ctcgccgccc tcgccgcgcc cggggtggcg       600
     gcgctcgcgc gccgcgcggc cgacgcgttc acgctcctgg cggagggagg gcccgacgcg       660
     ccgcgcgcca ccgccgccct cgcgggggac ctcatcgacc tccgcgaggc gctcgcgcgc       720
     gcgccggtgg ccccggcgcc cgcggaggcc ggaccgaccg gcgcggcggc ggccgcgaag       780
     gcgcgcggcg agcgctcgat ccgcgtgctc gcctcgaccc tcgactccat cggccgccag       840
     ttcgagctcc tcgcgctcgc cgaggcccgc cgggcccggc gcgcgcgcga cgtgctcggc       900
     cacgcggagg ccgtccgcgg cgcgctgcag tcgctcgacc acgcgaccag gaggctgcgc       960
     ggcgccggga tcgagaccgg ccgggccgag ctcgactccg cctcgacccg gctgcgggag      1020
     gtcgccgccg ccctcggcag ggtggcgctg gaggcccagc gcgaggcgga ggcgcagcgg      1080
     ctcgcgggca cggtcctccg cgaggatctg cgcggcctgc ggatggttcc ggccgcgctc      1140
     gtgctcgagc cgctgcggcg cgcggtgcgc gacgtcgcgg ggcggctcgg caaggaggtg      1200
     gagctcaccg tggagggcgg ggaggtgcgg ctcgatcgcc agatcgtgga cgcgctgcgg      1260
     gatccgctcc tgcacctcgt gcgcaacgcc gtggaccacg gcatcgaggc gcccgcggcg      1320
     cggcgcgacg cgggcaagcc gaccggtggc cggatcgccg tccgcgtcga gccgcgcggc      1380
     gcacgcgtgg ccatcgtcgt cgaggacgac gggccggggc tcgacgtcgg ggccatccgc      1440
     gccgccgcgg tgcgcaaggg gctcctcacg accgaggagg tcgatcgcct caccgacgcc      1500
     gaggcggccc ggctcgtctt ccacgccggc gtctccaccg cgcgcgccgt caccgagatc      1560
     tccggccgcg gcgtcggcat ggacgtggtc ctggagacgc tggcgcggct ccagggcacg      1620
     atcgacgtgc ggtgggaggc ggggcgcggc acccgcttcg atctggacgt gccgctcgcg      1680
     ctctcggcgt ccgcggcgct cgtggtccgc gtcgggcgcg acgtcgtcgc cgtgtcggcg      1740
     gacccgatcg agcacgtggt gctgctccgc gaccaggacc tcggcaccgt ggccggccgc      1800
     accaccgtcc tcgtcgccgg cgagcacgtg ccgtacgcgc cgctcgcccg gctgctgcgc      1860
     tcggaggagg gaggcggacc ggcgcgccag gccgtggcgc tggtgctcgc gcacggcggc      1920
     gcgcgcgtgg cggtcggggt ggacgagctc gtgggccagc aggagctcgt gatctcctct      1980
     ctcggcgggc tcgtggccca gatcgcgcac ctcgccgggg cggcggtgct cgacgacggc      2040
     cgcgtggtgg gcgtcctctc cgcgccggag ctcctccggc gcgcgcagcc cggcgccgcg      2100
     gcggcgcgcg cccgcgaggg cgggcggcgc gtgctggtcg ccgacgactc gctcaccacc      2160
     cgctccgcca tgaaggcgct cctcgagctg gccgggtacg cggtgctgcc ggccgccgac      2220
     ggcgaggagg cgctccagct gctgcgggag gcgggcgcgg acctcgtggt gtccgacgtc      2280
     cagatgcccc gcctggacgg cttcggcctc gcgcgcaagg tgaaggcgga tccgcgcctg      2340
     cgccgcacgc cggtgatcct cgtcacctcc ctcgacgccc cggaggaccg ggccaccggc      2400
     ctcgcggccg gcgccgacgg ctacctcgtg aagcgcgagg tcgagcgcgg caagctcctc      2460
     gacctcgtcc gccagctcct gccccgcgca tga                                   2493
//

If you have problems or comments...

PBIL Back to PBIL home page