(data stored in ACNUC7421 zone)

EMBL: CP000769.PE467

CP000769.PE467       Location/Qualifiers
FT   CDS_pept        complement(533789..534259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0472"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: ade:Adeh_3952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24687"
FT                   /db_xref="GOA:A7H7J1"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7J1"
FT                   /protein_id="ABS24687.1"
FT                   /translation="MKMIDVGAKPRTERVAIARGFVAMSRETVARVERGDVEKGDVLAA
FT                   ARLAGVMAAKKTPDLVPLCHPIALSGVETEVEPGPRGVAVTATVRTVDRTGVEMEALAA
FT                   VAAACLTIYDMLKRYEKGMRIEGLELVEKKGGRSGHWKREDAEARPRRRRSR"
     atgaagatga tcgacgtcgg cgcgaagccg aggacggagc gggtggcgat cgcgcgcggc        60
     ttcgtggcca tgtcgcggga gaccgtcgcg cgggtcgagc ggggggacgt ggagaagggc       120
     gacgtcctcg ccgccgcccg gctcgccggg gtcatggccg cgaagaagac gcccgacctc       180
     gtcccgctct gccaccccat cgcgctctcc ggcgtggaga cggaggtgga gccgggaccg       240
     cgcggcgtcg cggtgaccgc gacggtgcgc accgtcgacc ggaccggcgt cgagatggag       300
     gcgctcgcgg cggtggccgc cgcctgcctc acgatctacg acatgctgaa gcggtacgag       360
     aagggcatgc gcatcgaggg gctggagctc gtggagaaga agggcggccg gagcggccac       420
     tggaagcgcg aggacgccga ggcgcgtccc cgccgtcgcc gcagccgcta g                471
//

If you have problems or comments...

PBIL Back to PBIL home page