(data stored in ACNUC7421 zone)

EMBL: CP000769.PE471

CP000769.PE471       Location/Qualifiers
FT   CDS_pept        537459..538577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0476"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="TIGRFAM: 1-hydroxy-2-methyl-2-(E)-butenyl
FT                   4-diphosphate synthase; PFAM: IspG family protein; KEGG:
FT                   ade:Adeh_3949 1-hydroxy-2-methyl-2-(E)-butenyl
FT                   4-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24691"
FT                   /db_xref="GOA:A7H7J5"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7J5"
FT                   /protein_id="ABS24691.1"
FT                   /translation="MGGYGQGAAATLGERRKTRGIRLGNVPIGGGAPIAVQSMTTTQTS
FT                   DAPATLAQIRALAEAGADVVRVAVPDRDAAAALPAIVRASPVPLVADIHFDYRLALAAL
FT                   EAGIHGIRLNPGNIGARERVREVVHAARERLVPIRIGVNAGSLEKDIVEKHGWPTAEGM
FT                   VESAERHIRFLEDEGYREIKVSLKAHDVAMTVQANRLFSQRFEYPLHLGVTEAGTLLAG
FT                   TVKSAAGLGILLGDGIGDTIRVSLTADPVEEVRVARLLLKSLGLKFGGATMTSCPTCGR
FT                   CSVDMIPIAERVEKRLATLKGEVAVAVMGCEVNGPGEAAAADVGVAYGHNGVGLLFRGG
FT                   KIVKRMKAEELEDAVVAEAISIASSRTPGERD"
     atgggcggct acgggcaggg cgcggcggcg acgctgggtg agcggcggaa gacgcggggc        60
     atccgcctcg gcaacgtccc catcggcggc ggcgccccca tcgccgtgca gtcgatgacc       120
     accacgcaga cgtccgacgc gcccgcgacg ctcgcgcaga tccgcgcgct cgcggaggcg       180
     ggcgcggacg tggtgcgggt cgcggtgccc gaccgagacg cggcggcggc gctgccggcc       240
     atcgtgcgcg cctcgccggt gccgctcgtc gccgacatcc acttcgacta ccggctggcc       300
     ctcgccgcgc tcgaggcggg catccacggc atccgcctga acccgggcaa catcggcgcg       360
     cgggagcggg tgcgggaggt ggtccacgcg gcgcgcgagc ggctcgtgcc gatccgcatc       420
     ggcgtgaacg cgggctcgct cgagaaggac atcgtggaga agcacggctg gcccaccgcg       480
     gagggcatgg tcgagagcgc cgagcgccac atccgcttcc tcgaggacga gggctaccgc       540
     gagatcaagg tgtcgctgaa ggcgcacgac gtcgccatga cggtgcaggc gaaccggctc       600
     ttctcgcagc ggttcgagta cccgctgcac ctcggcgtca cggaggcggg cacgctcctc       660
     gccggcaccg tgaagagcgc cgccggcctc ggcatcctgc tgggggacgg gatcggcgac       720
     acgatccgcg tctccctcac cgccgacccg gtcgaggagg tccgcgtcgc gcgcctgctg       780
     ctcaagtcgc tcggcctcaa gttcggcggc gccacgatga cctcctgccc gacctgcggc       840
     cgctgctcgg tggacatgat ccccatcgcc gagcgcgtgg agaagcggct cgcgacgctg       900
     aagggcgagg tggcggtggc ggtgatgggc tgcgaggtga acggccccgg cgaggccgcg       960
     gccgccgacg tgggcgtggc ctacggccac aacggcgtgg gcctcctctt ccgcggcggc      1020
     aagatcgtga agcggatgaa ggccgaggag ctggaggacg ccgtggtcgc cgaggcgatc      1080
     agcatcgcct cgagccgcac gccgggcgag cgcgactag                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page