(data stored in ACNUC7421 zone)

EMBL: CP000769.PE472

CP000769.PE472       Location/Qualifiers
FT   CDS_pept        complement(538574..538909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3948 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24692"
FT                   /db_xref="GOA:A7H7J6"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7J6"
FT                   /protein_id="ABS24692.1"
FT                   /translation="MTRRARLAALAVAAVAVALAIALAAAPRGRPSLVGTPEALARGER
FT                   VFRAKCLHCHGDVPLARRVAGWTAERAYDAIGRLPQLYPVMPEFHGSDEDRRALAVYLS
FT                   AMGEGSD"
     gtgacccgcc gcgcccgcct cgccgccctc gccgtggccg ccgtcgcggt cgcgctggcg        60
     atcgcgctcg cggcggcgcc gcgcggccgg ccctcgctgg tggggactcc cgaggccctc       120
     gcgcggggtg agcgggtgtt ccgcgcgaag tgcctgcact gccacggcga cgtaccgctc       180
     gcgcggcgcg tggcggggtg gaccgcggag cgggcctacg acgccatcgg ccggctgccc       240
     cagctctacc cggtcatgcc ggagttccac ggcagcgacg aggaccggcg cgcgctcgcc       300
     gtgtacctct cggcgatggg cgagggcagc gactag                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page