(data stored in ACNUC7421 zone)

EMBL: CP000769.PE474

CP000769.PE474       Location/Qualifiers
FT   CDS_pept        540758..541879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24694"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7J8"
FT                   /protein_id="ABS24694.1"
FT                   /translation="MRARLSVGRDGEVLVPPREAEALGLGGGGEVDLVSARGAFALLVP
FT                   ARGDEAPRAWFAGSLAALTVPEVIQFVFTSLKTGVLLLAFGEDAARAAPDTPDRLRRKS
FT                   IYFRDGQVVFASSSDPSDRLGPVLLREGLVGEEELARCARLARAGRPLGQVLVDEGVLG
FT                   PGQLYEGVTRQVREIVLGAFAELTGEFAFLEGPVDDATAVKLPERTRELLLAGMKRLEE
FT                   AEAARAAATTPGPGEPEVTIEIAPPEPAAPARASGPFETYRRIFRRVHAALAAVTPDAA
FT                   DRLNGYLAQLPDKRRAPFAGVHVQHDGDLDVAQVLGNVSAAGAHRGAAARARALEALDE
FT                   LLAFALFEAKNRLPREEAERLLREVGRMQVGKG"
     gtgcgcgcgc ggctctcggt cgggcgcgac ggcgaggtcc tcgtgccgcc gcgcgaggcg        60
     gaggcgctcg ggctcggcgg cggcggggag gtcgacctcg tctccgcccg cggcgcgttc       120
     gcgctgctcg tgcccgcccg cggggacgag gcgccgcggg cctggttcgc ggggtcgctc       180
     gcggccctca ccgtgccgga ggtgatccag ttcgtcttca cctccctgaa gaccggcgtg       240
     ctcctcctcg ccttcggcga ggacgcggcc cgcgccgcgc ccgacacgcc cgaccggctg       300
     cgccgcaaga gcatctactt ccgcgacggg caggtggtgt tcgcctcgtc gagcgacccc       360
     tccgatcggc tcgggccggt cctcctgcgc gaggggctcg tcggggagga ggagctcgcg       420
     cgctgcgccc gcctcgcccg cgccgggcgc ccgctcgggc aggtcctcgt ggacgagggc       480
     gtcctcgggc ccggccagct ctacgagggc gtcacgcggc aggtccgcga gatcgtcctc       540
     ggcgcgttcg cggagctgac cggcgagttc gcgttcctcg agggcccggt ggacgacgcc       600
     accgcggtga agctgccgga gcggacccgg gagctcctcc tcgcggggat gaagcgcctc       660
     gaggaggcgg aggcggcgcg cgccgccgcc accacccccg ggccgggcga gcccgaggtc       720
     accatcgaga tcgcgccgcc cgagcccgcc gcgcccgcgc gcgcgagcgg gcccttcgag       780
     acctaccggc gcatcttccg gcgcgtgcac gcggcgctcg ccgcggtcac ccccgacgcc       840
     gcggatcgcc tgaacggcta cctggcccag ctcccggaca agcgccgcgc cccgttcgcg       900
     ggggtgcacg tccagcacga cggcgacctc gacgtcgcgc aggtgctcgg gaacgtgagc       960
     gcggccggtg cccaccgcgg ggcggcggcg cgggcgcggg cgctcgaggc gctcgacgag      1020
     ctgctcgcgt tcgcgctgtt cgaggccaag aaccggctgc cgcgcgagga ggccgagcgg      1080
     ctcctgcgcg aggtgggccg gatgcaggtg gggaaggggt ag                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page