(data stored in ACNUC7421 zone)

EMBL: CP000769.PE478

CP000769.PE478       Location/Qualifiers
FT   CDS_pept        complement(544741..545145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0483"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: rso:RS04693 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24698"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K2"
FT                   /protein_id="ABS24698.1"
FT                   /translation="MSTPGMIHLEHVYPHPPAAVWRALTDPELHARWWAAGDVRPVVGH
FT                   RFTLDMGRFGKQPCEVTAVEHERLFSYRFATGSLDTTVTWRLSAEGEGTRLSLTHEGFD
FT                   LDSPLARGAWEGMKGGWPAILERLGAALGA"
     atgagcaccc ccgggatgat ccacctcgag cacgtctatc cccacccacc ggccgcggtg        60
     tggcgcgccc tcaccgaccc cgagctccac gcgaggtggt gggccgccgg cgacgtgcgc       120
     cccgtggtcg gccaccgctt cacgctcgac atgggcaggt tcggaaagca gccgtgcgag       180
     gtgaccgcgg tcgagcacga gcggctgttc agctaccggt tcgcgaccgg ctcgctcgac       240
     accaccgtca cgtggcgcct ctccgcggag ggcgagggca ctcgtctgtc cctcacgcac       300
     gaggggttcg atctcgactc gcccctcgcc cgtggcgcct gggaggggat gaagggaggc       360
     tggcccgcga tcctcgagcg tctcggggcg gcgctgggcg catag                       405
//

If you have problems or comments...

PBIL Back to PBIL home page