(data stored in ACNUC7421 zone)

EMBL: CP000769.PE479

CP000769.PE479       Location/Qualifiers
FT   CDS_pept        complement(545142..545471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0484"
FT                   /product="regulatory protein ArsR"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: mpa:MAP1641c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24699"
FT                   /db_xref="GOA:A7H7K3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K3"
FT                   /protein_id="ABS24699.1"
FT                   /translation="MFPCMPQPDVFSALANPVRRNILMQLRKGPRAVKDLAAGFDVGRP
FT                   AISEHLQVLRQARLVREEPRGRERYYHLDPRPLSEVDTWLEAFSRYWERRLVALGEVLD
FT                   KEKTR"
     atgtttccct gcatgccgca gcccgacgtg ttctcggcgc tcgcgaatcc cgtccgccga        60
     aacatcctga tgcagctccg gaagggtcct cgcgccgtga aggacctcgc cgccggcttc       120
     gacgtggggc ggccggccat ctcggagcac ctccaggtgc tgcgccaggc gcggctcgtc       180
     cgcgaggagc cgcgcggacg cgagcggtat taccacctcg atccccgtcc cctctccgag       240
     gtggacacgt ggctcgaggc gttctcgcgc tactgggagc gccggctcgt ggccctcggc       300
     gaagtcctcg acaaggagaa gacgcgatga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page