(data stored in ACNUC7421 zone)

EMBL: CP000769.PE481

CP000769.PE481       Location/Qualifiers
FT   CDS_pept        complement(547320..549566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0486"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   mxa:MXAN_0210 transglycosylase SLT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24701"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K5"
FT                   /protein_id="ABS24701.1"
FT                   /translation="MWATAAPAQEAEGDAPVAESQLEDLLESASRSQGVTRRYTEGDFA
FT                   PYFASGELAEAKALFDRGSHARARARLRGEQPPVRYLRAVSALRDAPASAVVELRALAD
FT                   DYPRMRDHCLFHAARALERLRKRRAAADVYAQVSPGSTLYAEARLGRSRVLERGLDLDG
FT                   ALDALVPLRELPAIPRHDAVRRKALLAAARLCQKKGDYPCEHRAMLELWATSPLSREAK
FT                   VVWERLKELPIPNRWRLRRAESFLAFHDNLEALRLARQVKTPLPDEHACTASFVIGNAL
FT                   RKERQHRKAAAELGPMVEACKSSELRPQAMYVLGYSQSVIGQDAVRTYEALAHEYPGHA
FT                   FADDALFFAAELDLRGGRRAVALERLEQVAARYATGNFAPEALFRLAWEHRTAGAHEEA
FT                   LAALDRLDRLPGLGREQRLRSRYWRARTLADKGDAAAAPAFAALAADHPAEWYGLLARA
FT                   RLPDLAPLVASHRTASSYAAATVWPLEAGPLGDDPRFLAGVELLRMQLPDGAAELLAID
FT                   RRSLPEDAARLLVEALQRSGSSAAAAYVARTTLGRTLTGGIDDRTADVWRATYPLPFRS
FT                   LVERWAKASSVDPDLLQALMREESRFNPWARSATGARGLTQLMPRTAQDVARGLKLGRV
FT                   NPGMLHRPALNIRLGAAYLAELLSEYEGSMVRAVAAYNAGPVAVWRWVRARPDEDVDVW
FT                   VEKIPITETRDYVKRVLGSYGAYRHVYGRGAGPLEDRSPRARGDRGEPKPARRL"
     atgtgggcga cggcagctcc cgcgcaggag gccgagggcg acgctcccgt cgcggagagt        60
     cagctcgaag acctgctgga gagcgcctcg cgctcgcagg gggtcacccg ccgttacacg       120
     gagggcgact tcgcgcccta cttcgcctcg ggcgagctcg ccgaggccaa ggcgctcttc       180
     gaccgtggca gccatgcgcg cgcacgcgcg cggctgcgtg gagagcagcc gccggtgcgg       240
     tacctgcgcg ccgtgtccgc gctgcgcgac gcccccgcct cggcggtcgt cgagctccgg       300
     gccctcgccg acgactaccc gcggatgcgg gaccactgcc tcttccacgc ggcacgcgcc       360
     ctggagcggc tgcggaagcg ccgcgccgcc gccgacgtct acgcgcaggt gagccccggc       420
     tccacgctct acgccgaggc ccggctcggg cgctcccggg tgctcgagcg cgggctggat       480
     ctcgacgggg cgctcgacgc gctcgtcccg ctgcgcgagc tgccggccat ccctcgccac       540
     gatgcggtga gacggaaggc gctgctcgcc gccgcgcggc tgtgccagaa gaagggcgac       600
     tacccgtgcg agcaccgggc catgctcgag ctgtgggcca cgagcccgct ctcgcgcgag       660
     gcgaaggtcg tctgggaacg cctgaaggag ctcccgatcc cgaaccgatg gcggctgcgg       720
     cgagccgagt cgttcctcgc gttccacgac aacctcgagg cgttgcggct ggcgcggcag       780
     gtgaagaccc cgctgcccga cgagcacgcc tgcaccgcgt cgttcgtgat cggcaacgcg       840
     ctccggaagg agcggcagca ccgcaaggca gccgcggagc tcggaccgat ggtcgaggcg       900
     tgcaagagct ccgagcttcg gcctcaggcg atgtacgtgc tcgggtattc gcagtcggtg       960
     atcgggcagg acgcggtgcg cacctacgag gcgctggcgc acgagtaccc cggccacgcc      1020
     ttcgccgacg acgcgctgtt cttcgccgcc gagctcgacc tgcgcggcgg acgacgggcc      1080
     gtcgcgctgg agcgactcga gcaggtggcc gcccgctacg ccacgggcaa cttcgctccc      1140
     gaggcgctct tccggctcgc gtgggagcac cggacggccg gcgcgcacga ggaggcgctc      1200
     gccgcgctcg accggctgga ccgcctcccc ggcctcgggc gcgagcagcg cctccggtcg      1260
     cgctactggc gggcgcgcac gctcgcggac aagggcgacg ccgcggccgc gcccgcgttc      1320
     gccgcgctgg ccgccgatca ccccgcggag tggtacggcc tgctcgcccg cgcgcggctc      1380
     cccgacctcg cgccgctcgt ggcgtcccac cgcacggcgt cgtcctacgc ggcggcgacg      1440
     gtgtggccgc tggaggcggg gccgctgggg gacgacccgc ggttcctcgc gggggtggag      1500
     ctcctgcgga tgcagctgcc cgacggcgcg gccgagctgc tcgccatcga tcggcgcagc      1560
     ctgcccgagg acgcggcgcg cctgctcgtg gaagccctgc agcgaagcgg gagctccgcg      1620
     gccgccgcct acgtcgcgcg caccacgctc gggcgcacgc tgacgggcgg gatcgacgat      1680
     cgcaccgccg acgtctggcg cgcgacgtac ccgctgccct tccggagcct ggtcgagcga      1740
     tgggcgaagg cctcgagcgt cgatccggat ctcctgcagg cgctgatgcg ggaggagagc      1800
     cgcttcaacc cgtgggcgcg ctcggcgacc ggtgcccgcg gcctcacgca gctgatgccg      1860
     cgcaccgcgc aggacgtggc gcgcgggctg aagctcggcc gcgtgaaccc gggcatgctg      1920
     caccggcctg cgctcaacat ccgcctgggc gcggcctacc tcgcggagct gctctcggag      1980
     tacgagggct cgatggtccg ggcggtggcg gcctacaacg cgggcccggt cgcggtgtgg      2040
     cgatgggtgc gggcgaggcc ggacgaggac gtcgacgtgt gggtcgagaa gatccccatc      2100
     acggagacgc gggactacgt gaagcgcgtc ctcgggagct acggggcgta tcgtcacgtc      2160
     tacggcaggg gagccggtcc gctcgaggac cgctcgcctc gcgcccgcgg cgatcgcggg      2220
     gagccgaagc ccgcgaggcg cctgtag                                          2247
//

If you have problems or comments...

PBIL Back to PBIL home page