(data stored in ACNUC7421 zone)

EMBL: CP000769.PE483

CP000769.PE483       Location/Qualifiers
FT   CDS_pept        complement(550979..551935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0488"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mxa:MXAN_2240 oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24703"
FT                   /db_xref="GOA:A7H7K7"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K7"
FT                   /protein_id="ABS24703.1"
FT                   /translation="MQASVPAQMRAAAFDRYGGPEVLHTETLPVPQPGPTQVLIRLDSA
FT                   GIGAWDPYLRSGEVELGPSGFPRVIGNDGAGEVVAVGDRVRGFRIGDRVYAYSFDAGFY
FT                   AEYVAVNEDEVAQIPRGLSAEEAGVLGADGVTAVRGLDDQLHLGPGQTLLVYGASGGIG
FT                   HLAVQLAKRMGARVLAVASGRDGVELVRRLGADAAVDGKRDDVARAARDFAPAGLDAAL
FT                   VLVHGESLDPALSAMRKGGRVAHPNGVEPAPTAPPGVTLLSYDGQPGRDAFEQLNRLIG
FT                   AGPFHVEIGRVYALDDAARAHREIGRHHLGKLALRIH"
     atgcaagcgt ccgttccagc gcagatgaga gcagcggcat tcgatcggta cggcggcccg        60
     gaggtcctcc acaccgagac gctcccggtg ccgcagccgg ggccgaccca ggtcctcatc       120
     cggctggact cggccggcat cggcgcctgg gatccctacc tccggtccgg ggaggtcgag       180
     ctcggtccga gcgggtttcc gcgcgtcatc ggcaacgacg gagcgggcga ggtggtcgcg       240
     gtgggcgatc gcgtgcgcgg gttccgcatc ggcgatcgcg tctacgcgta ctccttcgac       300
     gccgggttct acgcggagta cgtcgcggtg aacgaggacg aggtcgcgca gatcccacgc       360
     ggtctgagcg ccgaggaggc gggcgtgctc ggcgcggacg gcgtgacggc ggtgcgcggc       420
     ctggacgatc agctgcacct cgggccggga cagacgctcc tggtgtacgg cgcgagcggc       480
     gggatcgggc acctggcggt gcagctcgcg aagcgaatgg gcgcgagggt cctcgcggtc       540
     gcctccgggc gggacggcgt cgagctggtc cggaggctcg gggcggacgc ggccgtggac       600
     ggcaagcggg acgacgtcgc gcgggcggcg cgtgacttcg cgcctgccgg tctggacgcc       660
     gcgctcgtgc tcgtccacgg cgagagcctc gaccccgcgc tctccgcgat gcgcaagggc       720
     ggccgcgtcg cgcaccccaa cggcgtcgag ccggcgccga ccgcgcctcc cggggtgacc       780
     ctgctctctt acgacggcca gccgggccgc gacgcgttcg agcagctcaa ccggctcatc       840
     ggcgccggcc cgttccacgt cgagatcggg cgggtgtacg cgctcgacga cgcggcgcgg       900
     gcgcaccgcg agatcggacg gcaccacctc ggcaagctcg ccctgcggat tcattag          957
//

If you have problems or comments...

PBIL Back to PBIL home page