(data stored in ACNUC7421 zone)

EMBL: CP000769.PE484

CP000769.PE484       Location/Qualifiers
FT   CDS_pept        552073..552765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0489"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: ade:Adeh_0466 sigma-24
FT                   (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24704"
FT                   /db_xref="GOA:A7H7K8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7K8"
FT                   /protein_id="ABS24704.1"
FT                   /translation="MAQDAGSARGFQAGGAPDEAVVHRVLAGDTASFELLMRRHNQRVY
FT                   RTIRAVLRRDSADVEDAMQQTYLHAYRALAAFEGASSFGTWLTRIALNVALGFVRRQRV
FT                   AGVELSVEVDEMTRGARDEGPEDGAARSEAAALLERAVAQLRDEHRIVFVLREVEQLST
FT                   AETAEALELSEENVKVRLHRARLALREILAGEVGQSAPQAFAFLAPRCDRVVHSVLSSI
FT                   GARPRTSG"
     atggcacagg acgctggttc ggcgaggggc ttccaggcgg gcggcgcccc ggacgaggcc        60
     gtggtccacc gcgtactcgc gggggacacc gcgtcgttcg agctcctgat gcgccgccac       120
     aaccagcgcg tgtaccgcac catccgcgcg gtgctgcgcc gggactcggc ggacgtggag       180
     gacgcgatgc agcagaccta cctgcacgcc taccgggccc tcgccgcgtt cgagggggcg       240
     tcctcgttcg gtacgtggct gacgcggatc gcgctcaacg tcgcgctcgg cttcgtgcgg       300
     aggcagcgcg tcgccggcgt ggagctctcg gtggaggtgg acgagatgac ccgcggcgcg       360
     cgcgacgagg ggcccgagga cggagcggcg aggagcgaag ccgccgcgct gctggagcga       420
     gcggtcgccc agctgcgcga cgagcaccgc atcgtgttcg tgctgcggga ggtcgagcag       480
     ctctccaccg ccgagaccgc ggaggcgctc gagctctcgg aggagaacgt gaaggtgcgg       540
     ctccaccggg cgcgcctcgc gctgcgcgag atcctcgccg gggaggtcgg ccagtccgcg       600
     ccgcaggcgt tcgcgttcct cgctccccgc tgtgaccggg tcgtccactc ggtgctctcc       660
     tcgatcggcg cccgaccgcg gacgagcgga tag                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page