(data stored in ACNUC7421 zone)

EMBL: CP000769.PE486

CP000769.PE486       Location/Qualifiers
FT   CDS_pept        complement(555013..555474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0885 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24706"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7L0"
FT                   /protein_id="ABS24706.1"
FT                   /translation="MAAIPAKHSIGDAIDAAVEAAVARALPSLRRAIDAAVAAGVRAGK
FT                   PSARVAARTPVPAAPARTARRNVAVPRAGEITRWVADQRARRVPTFVIEATGLDTKKQI
FT                   VARFGANSAFAKGKPLPHAKPAQAPAAPAKTERVVKARPPIVRKAAAAK"
     atggctgcaa tcccggcgaa gcactccatc ggcgacgcga tcgacgccgc ggtagaggcg        60
     gccgtcgcgc gcgccctccc ctcgctgcgg cgggcgatcg acgccgccgt cgcggcgggc       120
     gtccgcgcgg gcaagccctc cgcgcgcgtc gctgcccgca cccccgtccc cgccgcgccc       180
     gcgcggaccg cgcgccggaa cgtggcggtg ccgcgggccg gcgagatcac ccgctgggtc       240
     gcggaccagc gcgcgcgccg cgtcccgacc ttcgtcatcg aggcgaccgg cctcgacacg       300
     aagaagcaga tcgtcgcccg cttcggcgcg aactccgcgt tcgcgaaggg caagccgctc       360
     ccgcacgcga agcccgcgca ggcgcccgcc gcgcccgcga agaccgagcg cgtggtgaag       420
     gcgaggccgc ccatcgtgcg gaaggccgcg gcggcgaagt ag                          462
//

If you have problems or comments...

PBIL Back to PBIL home page