(data stored in ACNUC7421 zone)

EMBL: CP000769.PE493

CP000769.PE493       Location/Qualifiers
FT   CDS_pept        561609..563192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3935 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24713"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7L7"
FT                   /protein_id="ABS24713.1"
FT                   /translation="MRIAVALAALAVATASLGQERPTEEELFGKPPAESPQATGEEEQE
FT                   PQPRQPEERPGSPRPEEAELFGGTGSPNAAPPPAEGILPRDVADPLRLGGQLYLRAQAL
FT                   WQEEVAPADWSLSTPNLLDLWLDARPNDRVRAFTLARMRYDPTAPETDESALPAAEQAL
FT                   LTDATSTRGLVTGVRGPRVLLDQLWVNFDVGRHVFVTAGKQHVKWGVGKFWNPTDYLHP
FT                   VRRDPLAVFDERTGTTMVKVHVPWERRGWNAYGVALLEDVAGRVEPTNRVGRIGVGGRA
FT                   EIVAGTVELGADALAQDGRRPRFGVDVSAGIWDLDVYAEAALRTSRDAPRWTEVDPGAP
FT                   LVARYARDDPEGFTPAVVLGGSWSANYSDEDALTVGAEYSFDDAGYDSKDVYPFLLAGA
FT                   PELTGELAAPFRQRDPTAFRPFYLGRHYAGAFLLLPSPGRWNDTTVTLSVLGNLSDRSF
FT                   VARLDHAVLALTYLRVESFVAASFGARGGEFRLGLDVPLSDVAPGLPSDQAISVPAPVL
FT                   QLGLALRVAL"
     atgaggatcg ccgtcgcgct cgccgcgctc gccgtcgcca cggcctcgct cgggcaggag        60
     cgtcccaccg aggaggagct cttcgggaag ccccccgcag agtcgccgca ggcgaccggc       120
     gaggaggagc aggagccgca gccccggcag cccgaggagc gccccgggtc gccgcggccg       180
     gaggaggcgg agctgttcgg cgggaccggc tccccgaacg cggcgccgcc gccggcggag       240
     gggatcctgc cgcgcgacgt cgccgatccg ctgcgcctgg gcggacagct ctacttgcgc       300
     gcgcaggcgc tgtggcagga ggaggtcgct cccgcggact ggtcgctctc cacgccgaac       360
     ctgctcgacc tgtggctgga cgcacgcccg aacgatcgcg tgcgcgcctt caccctcgcg       420
     cgcatgcgct acgacccgac cgccccggag acggacgaga gcgcgctccc cgccgccgag       480
     caggcgctcc tgaccgacgc caccagcacg cgcgggctcg tcacgggcgt gcgcggcccg       540
     cgggtgctcc tcgatcagct gtgggtgaac ttcgacgtcg gacggcacgt cttcgtgacc       600
     gccggcaagc agcacgtcaa gtggggcgtg ggcaagttct ggaaccccac cgactacctg       660
     caccccgtgc gacgcgaccc cctcgcggtg ttcgacgagc ggaccggcac gacgatggtc       720
     aaggtccacg tgccgtggga gcggcgcggc tggaacgcct acggcgtggc gctgctcgag       780
     gacgtcgccg ggcgggtgga gcccacgaac cgggtcggca ggatcggggt gggcgggcgc       840
     gcggagatcg tggccgggac cgtcgagctc ggggccgacg cgctcgccca ggacggccgg       900
     cgcccgcgct tcggcgtgga cgtctcggcg gggatctggg acctcgacgt ctacgcggag       960
     gcggccctcc gcacgagccg cgacgcgccg cgctggacgg aggtggaccc gggggccccc      1020
     ctcgtggcgc gctacgcccg cgacgatccg gagggcttca cgccggcggt ggtgctcggc      1080
     gggagctggt ccgcgaacta cagcgacgag gacgcgctca cggtcggcgc cgagtactcc      1140
     ttcgacgacg ccggctacga ctccaaggac gtctacccgt tcctcctcgc cggcgcgccg      1200
     gagctcaccg gggagttggc ggcgcccttc cggcagcgcg atccgaccgc cttccggccg      1260
     ttctacctgg gccggcacta cgcgggcgcg ttcctgctcc tcccttcacc gggccgctgg      1320
     aacgacacga ccgtcacgct ctccgtgctc ggaaacctgt cggaccggag cttcgtcgcc      1380
     cgcctcgatc acgccgtcct cgcgctcacg tacctgcgcg tcgagtcctt cgtcgcggcc      1440
     tcgttcggcg cgcgcggcgg cgagttccgg ctcggcctgg acgtcccgct ctccgacgtc      1500
     gccccagggc tgccgtcaga ccaggccatc tccgtcccgg ctcccgtgct ccagctcggg      1560
     cttgccctcc gcgtggccct ctag                                             1584
//

If you have problems or comments...

PBIL Back to PBIL home page