(data stored in ACNUC7421 zone)

EMBL: CP000769.PE494

CP000769.PE494       Location/Qualifiers
FT   CDS_pept        563357..563728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0500"
FT                   /product="protein of unknown function DUF302"
FT                   /note="PFAM: protein of unknown function DUF302; KEGG:
FT                   ade:Adeh_3932 protein of unknown function DUF302"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24714"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7L8"
FT                   /protein_id="ABS24714.1"
FT                   /translation="MRKQVSGKYDEVLAKIPELLKGEGFGVLTRIDVTATVKEKLGVDF
FT                   RRYQILGACNPKLAHQALTYEVGLGVMLPCNVAVWEDDAGKVIVSAVDPLQTIASQDPN
FT                   LEPIARQVREKLSRVLAQL"
     atgcggaagc aggtgagcgg caagtacgac gaggtgctcg cgaagatccc cgagctgctc        60
     aagggggagg gcttcggcgt cctcacgcgc atcgacgtga ccgcgacggt gaaggagaag       120
     ctcggcgtcg acttccggcg ctaccagatc ctcggcgcgt gcaacccgaa gctcgcccat       180
     caggcgctca cctacgaggt cggcctcggc gtcatgctgc cctgcaacgt ggcggtgtgg       240
     gaggacgacg cgggcaaggt gatcgtctcc gcggtcgatc cgctgcagac gatcgcctcg       300
     caggacccga acctcgagcc catcgcccgg caggtgcgcg agaagctctc ccgcgtcctc       360
     gcgcagctct ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page