(data stored in ACNUC7421 zone)

EMBL: CP000769.PE500

CP000769.PE500       Location/Qualifiers
FT   CDS_pept        complement(572701..574062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0506"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; AAA ATPase;
FT                   KEGG: ade:Adeh_3091 sigma54 specific transcriptional
FT                   regulator with PAS sensor, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24720"
FT                   /db_xref="GOA:A7H7M4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7M4"
FT                   /protein_id="ABS24720.1"
FT                   /translation="MPRLPEHSPSLFPDVDTVESLRRVADALPEGVFVTDRDGKVTFWN
FT                   RGAERITGWSRDEAIGQRCSLLAGDYVNGCTCGAGPLYCGIAERSRTARRCTLRTRDGR
FT                   PQVIVKNAIALYAADGTPVGTLETFTDVDPGPELACALGGAVAATAPGDLCGLVGRHPA
FT                   MVELYRMIRLVARSSATVMITGESGTGKDRIAEAIHSLGERAAGPLIRYSCAALDPGAA
FT                   EGELFGTSDGRRGRIASAERGTLLLDEVSGAPPALQTKLLRLVEDRTFTARDAAPIPAD
FT                   VRILCTTQRDLRHLVQEGRFRADLYFRLAAFPLHVPALRERIDDVPLLAERFLAEQRAA
FT                   GHAVGTLSPQTLRVLRAYPWPGNVRELRNTIEYAALVAGAGEIAPEHLPRDVLESRAAP
FT                   GTPCDPDVDARRALVEALERTGWNRTRAAELLGVSRVTLWKRMRRLGVADPGER"
     ttgccgcgct tgcccgagca ttcgccgtcc ctcttccccg acgtggacac cgtggagagc        60
     ctgcgccgcg tcgcggacgc gctcccggag ggggtcttcg tcaccgatcg ggacgggaag       120
     gtgacgttct ggaaccgcgg cgcggagcgg atcaccggct ggtcgcggga cgaggcgatc       180
     ggccagcgct gctcgctgct cgccggggat tacgtgaacg ggtgcacctg cggcgccggc       240
     ccgctctact gcgggatcgc ggagcgctcg cgcaccgccc ggcgctgcac gctccgcacg       300
     agggacggtc gtccgcaggt catcgtcaag aacgcgatcg cgctctacgc ggcggacgga       360
     acgccggtgg gcacgctcga gaccttcacc gacgtggacc ccgggcccga gctggcgtgc       420
     gcgctcggcg gggccgtcgc cgcgaccgcg ccgggtgacc tgtgcggcct cgtcggccgg       480
     cacccggcca tggtcgagct gtatcgcatg atccggctcg tcgcccgctc gagcgcgacc       540
     gtgatgatca ccggcgagag cgggaccggg aaggatcgca tcgccgaggc gatccactcg       600
     ctcggcgaac gcgcggcggg cccgctgatc cgctactcgt gcgcggcgct cgatcccggc       660
     gccgccgaag gcgagctgtt cgggacctcc gatggccggc gcggccggat cgcgagcgcg       720
     gagcgcggga cgctgctcct cgacgaggtg tccggcgcac cccccgcgct ccagacgaag       780
     ctcctccgcc tggtcgagga ccgcacgttc acggcccgcg acgcggctcc gatccccgcc       840
     gacgtccgca tcctctgcac cacccagcgc gatctgcgcc acctcgtcca ggaggggcgc       900
     ttccgcgccg atctgtactt ccgcctggcc gcgttccccc tccacgtccc cgccctgcgg       960
     gagcggatcg acgacgtgcc gctgctcgcg gaacggttcc tcgcggagca gcgagcggcg      1020
     gggcatgccg tgggcacgct gtcgccgcag acactccgcg tgctccgcgc gtatccgtgg      1080
     ccgggcaacg tccgcgagct ccgcaacacg atcgagtacg cggcgctggt cgccggcgcg      1140
     ggcgagatcg cgccggagca cctcccccgc gacgtcctcg agtcccgcgc cgcccctggc      1200
     acgccgtgcg atcccgacgt ggacgcccgg cgcgcgctcg tcgaggcgct ggagcgcacc      1260
     ggctggaacc ggacccgcgc cgccgagctg ctcggcgtgt cgcgcgtcac gctctggaag      1320
     cgcatgcgtc gcctcggcgt cgccgacccg ggcgagcgct ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page