(data stored in ACNUC7421 zone)

EMBL: CP000769.PE503

CP000769.PE503       Location/Qualifiers
FT   CDS_pept        576725..577984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24723"
FT                   /db_xref="GOA:A7H7M7"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7M7"
FT                   /protein_id="ABS24723.1"
FT                   /translation="MRALDFASPLARRRYARDDRPPESYNARVTILLGYGARPLPLPDV
FT                   PGARVLLPPVAPPVAELAAALDAALAHPVGARPLASVATARTRVVVIVSDSSRDEPRSE
FT                   LFSAVRRALAAVPDDHLTVAVANGTHGPKPLERLGLPEEVLRRHRVVNHDARDDASMVE
FT                   MGRTSRGTRIRVNRCVAEADLVVSTGKVKPHYFAGWGGGAKGIFPGLGHDVDIRQNHKL
FT                   KADPASALGRADGNPCREDIEEAVRRIGRDTYLVNVVEAGATILGAVAGDVVYAHREAV
FT                   RLARPWCEVEAAPADIVVVSAPLPVSGSLYQASKLIPPAGLLLREGGVVIVAAECPEGT
FT                   GPLKVVNEGIFELGVRRYLPAGATVLLVSGMDEATVRGTYATYAPDLASAIARARALVA
FT                   KSDPSVLVLPDAGDLVPRAG"
     gtgcgggccc tcgacttcgc gtctccgctg gcgcggagac gctacgctcg ggatgaccgg        60
     ccgccagagt cgtacaatgc tcgggtgacc atcctcctcg gctacggcgc ccgtccgctc       120
     ccgctgccgg atgtacccgg cgcccgcgtg ctcctcccgc ccgtcgcccc gccggtggcc       180
     gagctcgccg cggcgctcga cgccgccctc gcccacccgg tgggcgcccg cccgctcgcc       240
     tccgtggcca cggcacggac gcgggtcgtc gtgatcgtga gcgactcgtc gcgagacgag       300
     ccgcggtccg agctgttctc cgcggtccgc cgtgcgctcg cggccgtgcc cgacgaccac       360
     ctcaccgtcg ccgtcgcgaa cgggacgcac ggtccgaagc cgctcgagcg gctcggcctg       420
     cccgaggagg tgctgcggcg ccaccgcgtg gtgaaccacg acgcgcgcga cgacgcctcg       480
     atggtggaga tggggcggac gagccgcggc acgcgcatcc gcgtgaaccg ctgcgtcgcc       540
     gaggcggacc tcgtcgtgtc gaccggcaag gtgaagccgc actatttcgc cggctggggc       600
     ggcggcgcga aggggatctt cccggggctg ggacacgacg tcgacatccg ccagaaccac       660
     aagctgaagg ccgatcccgc ctcggcgctc ggccgcgccg acgggaaccc gtgccgcgag       720
     gacatcgagg aggccgtccg caggatcggg cgcgacacct acctcgtgaa cgtcgtcgag       780
     gcgggcgcca ccatcctggg cgccgtcgcg ggcgacgtcg tctacgcgca tcgcgaggcg       840
     gtgcggctcg cgcgcccgtg gtgcgaggtc gaggcggcgc ccgcggacat cgtggtcgtc       900
     tcggcgccgc tgccggtgtc cggctcgctc taccaggcgt cgaagctcat cccgcccgcg       960
     ggcctgctgc tccgcgaggg cggcgtggtg atcgtggccg ccgagtgccc cgagggcacc      1020
     gggccgctca aggtggtgaa cgaggggatc ttcgagctgg gcgtgcgccg ctacctgccc      1080
     gccggcgcga cggtgctgct cgtctccggc atggacgagg cgacggtgcg cgggacgtac      1140
     gcgacctacg cgcctgacct cgcgagcgcg attgcgcgcg cccgcgcgct cgtggcgaag      1200
     tcggatccga gcgtgctcgt gctgcccgac gcgggggatc tggtgccgcg ggcgggctga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page