(data stored in ACNUC7421 zone)

EMBL: CP000769.PE510

CP000769.PE510       Location/Qualifiers
FT   CDS_pept        complement(582760..583899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0516"
FT                   /product="hydrogenase formation HypD protein"
FT                   /note="PFAM: hydrogenase formation HypD protein; KEGG:
FT                   ade:Adeh_0474 hydrogenase formation HypD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24730"
FT                   /db_xref="GOA:A7H7N4"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7N4"
FT                   /protein_id="ABS24730.1"
FT                   /translation="MAGKDLFQELKFRDPVRARALAEAIAREVDAIGRTVPVMHVCGSH
FT                   EQAIARFGLRAVLPPGLELIMGPGCPVCVTDGPEVDEAVALALQGARVCTYGDMLRLPG
FT                   TARSLADAQADGAKVEVVYSVSQAVELAQKHPEDEVVFLGSGFETTAVATAAVALASPP
FT                   KNFSILSVHKYVPAAMNVVAESPQTNIEGYIAAGHAAIITGWGIFEPFAARTGKPVVVA
FT                   GFEPLDILAAILQLVELMRQGKAEVANVYPRCVTKEGNLPAQRSLWKVFRPVTGTWRGI
FT                   AEVRDGNLDLRPEYAHLDARKRFRIDTAPVRDEDAEEAAKGCICGSIMLGLANPGDCAL
FT                   FGKTCVPESPVGACMVSSEGQCRIWHTYGGVPDLRKVGT"
     atggcaggca aggatctctt ccaggagctg aagttccggg acccggtgcg cgcgcgcgcc        60
     ctcgcggagg ccatcgcccg agaggtcgac gccatcggcc ggacggtgcc ggtgatgcac       120
     gtctgcggca gccacgagca ggcgatcgcg cgcttcgggc tgcgcgcggt gttgccgccc       180
     ggcctcgagc tcatcatggg cccgggctgt ccggtgtgcg tgaccgacgg ccccgaggtg       240
     gacgaggccg tcgcgctcgc cctccagggc gcgcgcgtct gcacctacgg cgacatgctg       300
     cgcctccccg gcacggcgcg gtcgctcgcc gatgcccagg cggacggcgc gaaggtcgag       360
     gtcgtctact ccgtctcgca ggcggtcgag ctcgcccaga agcacccgga ggacgaggtg       420
     gtcttcctgg gctcgggctt cgagaccacc gcggtggcca ccgcggccgt ggcgctcgcg       480
     agcccgccga agaacttctc catcctctcg gtgcacaagt acgtgcccgc ggcgatgaac       540
     gtcgtcgccg agagcccgca gacgaacatc gagggctaca tcgcggcggg gcacgccgcc       600
     atcatcacgg gctgggggat cttcgagccg ttcgccgccc gcaccggcaa gccggtggtg       660
     gtggccggct tcgagccgct cgacatcctc gccgccatcc tccagctcgt ggagctcatg       720
     cggcagggga aggcggaggt cgcgaacgtc tacccgcgct gcgtgaccaa ggaggggaac       780
     ctccccgccc agcgcagcct gtggaaggtg ttccgtcccg tgaccggcac gtggcgcggc       840
     atcgccgagg tccgcgacgg gaacctggac ctcaggcccg agtacgcgca cctcgacgcg       900
     cgcaagcgct tccggatcga cacggcgccc gtgcgcgacg aggacgccga ggaagcggcg       960
     aagggctgca tctgcggctc gatcatgctc ggcctcgcga acccgggcga ctgcgcgctc      1020
     ttcgggaaga cctgcgtccc ggagtcgccg gtgggcgctt gcatggtgtc gtcggagggg      1080
     cagtgccgca tctggcacac ctacggcggc gtcccggatc tcaggaaggt cggaacctag      1140
//

If you have problems or comments...

PBIL Back to PBIL home page