(data stored in ACNUC7421 zone)

EMBL: CP000769.PE511

CP000769.PE511       Location/Qualifiers
FT   CDS_pept        complement(583955..584242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0517"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /note="TIGRFAM: hydrogenase assembly chaperone hypC/hupF;
FT                   PFAM: hydrogenase expression/formation protein (HUPF/HYPC);
FT                   KEGG: ade:Adeh_0475 hydrogenase assembly chaperone
FT                   HypC/HupF"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24731"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7N5"
FT                   /protein_id="ABS24731.1"
FT                   /translation="MCLGVPGKVVAIDGMSATVDFFGVKKELRLDIVDEPVSVGDYVLN
FT                   HVGFAIRRIPPDEVQETLALFDQILDVTGAKADLMAEDVRGEIAAAKHKA"
     atgtgcctcg gtgtcccagg gaaggtcgtc gcgatcgacg gcatgagcgc cacggtggac        60
     ttcttcggcg tgaagaagga gctgcggctc gacatcgtcg acgagccggt ctcggtcgga       120
     gactacgtgc tgaaccacgt cggcttcgcc atccgccgca tcccgccgga cgaggtgcag       180
     gagacgctcg cgctcttcga ccagatcctc gacgtcaccg gcgcgaaggc ggacctcatg       240
     gccgaggacg tgcgcggcga aatcgcggcc gcgaagcaca aggcgtga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page