(data stored in ACNUC7421 zone)

EMBL: CP000769.PE513

CP000769.PE513       Location/Qualifiers
FT   CDS_pept        complement(586659..587228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0519"
FT                   /product="zinc finger HypF domain protein"
FT                   /note="PFAM: zinc finger HypF domain protein; KEGG:
FT                   ade:Adeh_0476 (NiFe) hydrogenase maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24733"
FT                   /db_xref="GOA:A7H7N7"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7N7"
FT                   /protein_id="ABS24733.1"
FT                   /translation="MASFVMCEACAREYADPCDRRFHAQPNACPACGPRVRVVARDGAP
FT                   VEAADPIGHVGRALAAGAIAAVKGIGGFHLACDGTSSAAVVTLRARKRREEKPLAVMVR
FT                   DLDEARRVAEVGEAEAALLTSVERPIVLNPIARPRVPRLVRGSAARPPGVPPVPSPALR
FT                   ATGSFPPIKGRFSPAVPCGGAAVRRK"
     atggcctcgt tcgtcatgtg cgaggcctgc gcgcgcgagt acgccgaccc ctgtgaccgc        60
     cgcttccacg cgcagccgaa cgcctgcccc gcctgcgggc cgcgcgtgag ggtcgtcgcg       120
     cgggacggcg cgccggtcga ggcggccgat cccatcggcc acgtcggccg ggcgctcgcc       180
     gcgggcgcga tcgcggcggt gaaggggatc ggcgggttcc atctcgcctg cgacgggacc       240
     tccagcgcgg cggtggtgac gctgcgggcg cgcaagcggc gcgaggagaa gccgctcgcg       300
     gtgatggtgc gcgacctcga cgaggcgcgc cgggtcgcgg aggtcggcga ggcggaggcg       360
     gctttgctca cctcggtgga gcgtcccatc gtgctcaatc caatcgcccg accgagagtt       420
     ccgcgcctcg tccgcgggtc cgcggcgcga ccgccaggtg tccccccggt cccctcaccc       480
     gcgctccgcg ccaccgggtc cttccctccg ataaaagggc ggttttcgcc cgcggtgcct       540
     tgcggcggcg cggccgtacg gcgtaaatag                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page