(data stored in ACNUC7421 zone)

EMBL: CP000769.PE517

CP000769.PE517       Location/Qualifiers
FT   CDS_pept        complement(590370..592106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0523"
FT                   /product="nickel-dependent hydrogenase large subunit"
FT                   /note="PFAM: nickel-dependent hydrogenase large subunit;
FT                   KEGG: ade:Adeh_0478 nickel-dependent hydrogenase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24737"
FT                   /db_xref="GOA:A7H7P1"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7P1"
FT                   /protein_id="ABS24737.1"
FT                   /translation="MGKLITIDPVTRIEGHLRIDVEVDGGAVKNAWSSGTMWRGIETIL
FT                   QGRDPRDAWVFTQRICGVCTTVHAIASVRSVENALGLEIPLNAQLIRNVIMSAHSLHDH
FT                   IVHFYALSALDWVDVVAALKADPEKAADLADSLGLQWAGNSKHALAAAKEKVAGFVQAG
FT                   QLGIFTNGYWGHPAMKLSPEVNLLAVAHYLQALDVQRKANQAVAILGSKTPNIQNLAVG
FT                   GVANAINLDSPAALNMEKLYQVKTLLEEVVTFVQQVYLPDVAAIAASYPDWLKYGAGVT
FT                   NYLAVPDMPTDAKMTQFDLPGGIIWNGDLSNVKPVTSWNDDYLRQNVTESIARAYYEGD
FT                   TVRQPWEGQTNPKYTGDWKAETPAPEKYTWVKAPRLEGKPVQVGPLAQVLVGYANGHES
FT                   IRKWSDWCLGTAGKIAGVKLTPAVLHSTLGRHAARAIRAATMGELALKHWKLLIENIGK
FT                   GDTAIFVDPMKNLKPGTYRGVGFHEAPRGTLSHWAVIETDGKEMKLANYQAVVPSTWNA
FT                   GPRDAKDQLGPYEKSLVGNPIADPKLPLEALRTIHSFDPCLACAIHTVDAEGEEISRVK
FT                   VL"
     atgggtaagc tcatcaccat cgaccccgtc acccgcatcg agggccacct ccgcatcgac        60
     gtcgaggtgg acggcggcgc ggtcaagaac gcctggtcct cgggcacgat gtggcgcggc       120
     atcgagacga tcctccaggg ccgcgacccg cgcgacgcct gggtgttcac ccagcgcatc       180
     tgcggcgtgt gcaccaccgt gcacgcgatc gcctcggtgc gcagcgtcga gaacgcgctc       240
     ggcctggaga tcccgctgaa cgcgcagctc atccgcaacg tgatcatgag cgcgcactcg       300
     ctccacgatc acatcgtcca cttctacgcg ctctccgcgc tcgactgggt ggacgtcgtc       360
     gccgcgctga aggcggatcc cgagaaggcg gcggacctcg ccgactcgct cggcctgcag       420
     tgggcgggga attcgaagca cgccctcgcg gcggcgaagg agaaggtggc gggcttcgtc       480
     caggccggcc agctcggcat cttcaccaac ggctactggg gccacccggc gatgaagctc       540
     tcgccggagg tgaacctcct cgccgtcgcg cactacctgc aggcgctgga cgtgcagcgc       600
     aaggcgaacc aggccgtcgc gatcctgggc tccaagacgc cgaacatcca gaacctcgcg       660
     gtgggcggcg tcgccaacgc gatcaacctg gacagcccgg cggcgctcaa catggagaag       720
     ctgtaccagg tgaagaccct cctcgaggag gtcgtcacct tcgtgcagca ggtctacctg       780
     ccggacgtcg ccgccatcgc ggcgagctac ccggactggc tcaagtacgg cgcgggcgtg       840
     acgaactacc tcgccgtgcc ggacatgccg accgacgcga agatgacgca gttcgacctc       900
     ccgggcggca tcatctggaa cggcgacctg tcgaacgtga agccggtcac gagctggaac       960
     gacgactacc tgcgccagaa cgtgacggag tcgatcgccc gcgcctacta cgagggcgac      1020
     acggtccgcc agccgtggga gggccagacg aacccgaagt acacgggtga ctggaaggcc      1080
     gagacgcccg cgccggagaa gtacacctgg gtgaaggcgc ctcgcctcga gggcaagccg      1140
     gtgcaggtcg gcccgctcgc gcaggtgctc gtcggctacg ccaacggcca cgagagcatc      1200
     cgcaagtggt cggactggtg cctcggtacg gccggcaaga tcgcgggcgt gaagctcacg      1260
     ccggccgtcc tccactccac gctcggccgc cacgccgccc gcgccatccg cgcggcgacc      1320
     atgggcgagc tggcgctcaa gcactggaag ctccttatcg agaacatcgg caagggcgac      1380
     acggccatct tcgtggaccc catgaagaac ctgaagcccg gcacctaccg cggcgtcggc      1440
     ttccacgagg cgccgcgcgg cacgctctcg cactgggcgg tgatcgagac cgacggcaag      1500
     gagatgaagc tcgcgaacta ccaggcggtc gtgccgtcca cctggaacgc gggcccgcgc      1560
     gacgccaagg accagctcgg cccctacgag aagtcgctcg tggggaaccc catcgccgat      1620
     ccgaagctgc cgctcgaggc gctccgcacc atccactcgt tcgacccgtg cctcgcctgt      1680
     gcgatccaca ccgtggacgc ggagggcgag gagatctccc gggtgaaggt gctgtag         1737
//

If you have problems or comments...

PBIL Back to PBIL home page