(data stored in ACNUC7421 zone)

EMBL: CP000769.PE519

CP000769.PE519       Location/Qualifiers
FT   CDS_pept        complement(593372..594322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0525"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: ade:Adeh_0480 Fe-S-cluster-containing
FT                   hydrogenase components 1"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24739"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7P3"
FT                   /protein_id="ABS24739.1"
FT                   /translation="MAITRRDLLKGAAVAGAATALAGKAEAREAVQPLPDAVGMLFDAT
FT                   RCVGCRACVTRCKEANELPYDRTPDGQYDAPNDLNGTTKNIIKAHPAGDSQTYMKQQCM
FT                   HCVDPSCVSVCMMGALHKEAQGKRLMKGERSVATGIVLWDKDLCVGCRYCQIGCAFNVP
FT                   KFEWDDAFPKIVKCELCRHRGDPKKEGPLAVANPACCEACPREAVIYGRRAELLAEAKR
FT                   RVAAEPERYEAKVYGEHDGGGTQVLYLAPKGVEFTALGLPVLPERSSAEFSEKVSHAPY
FT                   LHGLTPIALYAGLAFVIHRNRKKEEAAEHGPEGKR"
     atggccatca cacgacgaga cctgctcaag ggagcggccg tcgccggagc ggccaccgcg        60
     ctcgccggca aggccgaggc ccgcgaggcg gtccagcccc tgcccgacgc cgtcgggatg       120
     ctgttcgacg ccacccgctg cgtgggctgc cgcgcgtgcg tcacgcggtg caaggaggcc       180
     aacgagctcc cgtacgaccg caccccggac ggtcagtacg acgcgccgaa cgacttgaac       240
     ggcacgacga agaacatcat caaggcgcac ccggccggcg actcgcagac gtacatgaag       300
     cagcagtgca tgcactgcgt cgacccgtcg tgcgtgtcgg tctgcatgat gggcgcgctc       360
     cacaaggagg cgcagggcaa gcggctcatg aagggcgagc ggtccgtcgc gaccggcatc       420
     gtcctgtggg acaaggacct ctgcgtcggc tgccgctact gccagatcgg ctgcgccttc       480
     aacgtcccga agttcgagtg ggacgacgcg ttccccaaga tcgtgaagtg cgagctgtgt       540
     cgccaccgcg gcgacccgaa gaaggagggg cccctcgccg tcgcgaaccc cgcctgctgc       600
     gaggcctgcc cgcgcgaggc ggtgatctac gggaggcgcg ccgagctgct cgccgaggcg       660
     aagcggcgcg tggcggccga gccggagcgc tacgaggcga aggtgtacgg cgagcacgac       720
     ggcggcggga cccaggtcct gtacctcgcc cccaagggcg tggagttcac ggcgctgggg       780
     ctgccggtgc tgcccgagcg gtcgagcgcg gagttctcgg agaaggtctc ccacgcgccg       840
     tacctgcacg gcctcacgcc catcgcgctc tacgcggggc tcgccttcgt catccaccgc       900
     aaccgcaaga aggaagaggc ggccgagcac ggcccggagg gcaagcgatg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page