(data stored in ACNUC7421 zone)

EMBL: CP000769.PE520

CP000769.PE520       Location/Qualifiers
FT   CDS_pept        complement(594329..595510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0526"
FT                   /product="hydrogenase (NiFe) small subunit HydA"
FT                   /EC_number="1.12.99.6"
FT                   /note="TIGRFAM: hydrogenase (NiFe) small subunit HydA;
FT                   PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit;
FT                   Nickel-iron dehydrogenase small subunit domain protein;
FT                   KEGG: ade:Adeh_0481 hydrogenase (NiFe) small subunit
FT                   (HydA)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24740"
FT                   /db_xref="GOA:A7H7P4"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7P4"
FT                   /protein_id="ABS24740.1"
FT                   /translation="MLQFKTGAVVFAHPEDGMNDMRSEVLGLGTAKGVSRRDFIKVCTT
FT                   AAAAVGLPAWAGEKMAENVAKGRKPSVIWLHFQECTGCTESLLRTSHPDVGSLILDLVS
FT                   VDYHETLFAAAGLQIEEALEKAMHENEGKFVLVVEGAIPTKDGGIYCQVGGKKAVDTLS
FT                   EVAAKAGAVIAIGSCASWGGIPSAEPNPTGATGVPQLLKGKSVVTLPGCPANPYNLLGT
FT                   VLQYATFGTLPALDDLGRPKFAYGRVIHEDCQRRPHFDAGRFAQAFGDEGHRNGWCLYK
FT                   LGCKGPQTHANCSLLDFCEVPGAWPVAIGHPCVGCTEQGIGFHVPIYTNLPVERPTAPM
FT                   AYPAVHPDHDVLGRGNGAIAIGVGSAIAGAVIGAGVMATRKLTAEAEKEEGKE"
     atgttgcaat tcaagaccgg agcggtagtg ttcgcgcacc cggaggacgg aatgaacgac        60
     atgcgctccg aagtgctcgg cctggggacg gcgaagggcg tctcccgccg cgacttcatc       120
     aaggtctgca ccaccgcggc ggcggccgtg ggcctcccgg cctgggccgg cgagaagatg       180
     gccgagaacg tggccaaggg gaggaagccc tcggtcatct ggcttcactt ccaggagtgc       240
     accggctgca cggagtcgct gctccgcacg agccaccccg acgtcggctc gctgatcctc       300
     gacctcgtct cggtcgacta ccacgagacc ctcttcgcgg cggccggcct ccagatcgag       360
     gaggcgctcg agaaggcgat gcacgagaac gagggcaagt tcgtcctcgt cgtcgagggc       420
     gccatcccga cgaaggacgg cggcatctac tgccaggtcg gcggcaagaa ggcggtcgac       480
     acgctgagcg aggtcgccgc caaggccggg gcggtcatcg ccatcggctc gtgcgcctcg       540
     tggggcggga tcccctccgc cgagccgaac ccgaccggcg ccaccggcgt cccgcagctc       600
     ctgaagggca agagcgtggt gacgctgccc ggctgcccgg cgaaccccta caacctgctc       660
     ggcaccgtcc tccagtacgc caccttcggc accctcccgg ccctcgacga cctcggtcgc       720
     ccgaagttcg cctacggccg cgtcatccac gaggactgcc agcgccggcc gcacttcgac       780
     gcgggccgct tcgcgcaggc gttcggcgac gagggccacc gcaacggctg gtgcctctac       840
     aagctcggct gcaaggggcc gcagacgcac gccaactgct cgctgctcga cttctgcgag       900
     gtcccgggcg cgtggccggt cgccatcggc cacccgtgcg tcggctgcac cgagcagggc       960
     atcgggttcc acgtcccgat ctacacgaac ctgcccgtcg agaggccgac cgccccgatg      1020
     gcgtacccgg ccgtccaccc ggatcacgac gtgctcggcc gcggcaacgg cgccatcgcc      1080
     atcggcgtcg gcagcgccat cgccggcgcg gtcatcggcg cgggcgtcat ggccacgcgc      1140
     aagctcacgg ccgaggcgga gaaggaagag gggaaggagt ag                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page