(data stored in ACNUC7421 zone)

EMBL: CP000769.PE521

CP000769.PE521       Location/Qualifiers
FT   CDS_pept        complement(595945..597231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0527"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   sus:Acid_7416 protein of unknown function DUF195"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24741"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7P5"
FT                   /protein_id="ABS24741.1"
FT                   /translation="MDATALLLLALGLALGAVAGFLARSGDARRAAERAVRIAELEATL
FT                   AAERAGAEEKRALVEDARARLSDAFKALSADALRDSSASFLELARAALGRERAAAEGEL
FT                   ARRQEAIGSLLAPVRDALGRLDGELRAIERAREGAYGALTEQLRQVAEAQAQVRGEAAN
FT                   LVKALRAPQARGRWGELQLRRVVELAGMLDRCDFEEQATVEGDEGRLRPDLVVRLPGGR
FT                   NVVVDAKAPLSAYLEAIEARDDGERRARLADHARQLREHVQQLGRKAYWERLRPAPEFA
FT                   VLFLPGESFYAAALEADPTLLEASAERQVIVATPTTLIALLKAVAHGWRQAEVAENAEA
FT                   VAALGRELYKRIADLGGHFARLGRALGGTVEAYNRAVGSLEARVLPAARRFEALSAAPA
FT                   EAELPELAPLDLVPRDVVAPELADPFAAR"
     atggacgcga ccgctctcct cctcctcgcg ctcggcctcg cgctgggcgc ggtcgccgga        60
     ttcctcgcgc ggagcggcga cgcccggcgc gccgccgagc gggccgtgcg catcgccgag       120
     ctggaggcga cgctcgccgc ggagcgcgcc ggcgcggagg agaagcgggc gctcgtggag       180
     gacgcgcggg cgcgcctctc cgacgcgttc aaggcgctct ccgcggacgc gctccgcgac       240
     tcgagcgcgt cgttcctcga gctcgcgcgg gcggccctcg ggcgcgagcg cgccgcggcc       300
     gagggcgagc tcgcccgccg ccaggaggcc atcgggagcc tgctcgcccc ggtgcgcgac       360
     gccctcggcc ggctcgacgg ggagctgcgc gcgatcgagc gcgcgcggga gggggcgtac       420
     ggcgcgctca ccgagcagct ccggcaggtc gccgaggcgc aggcgcaggt ccgcggcgag       480
     gcggcgaacc tggtgaaggc gctccgcgcg ccgcaggccc gtggccgctg gggcgagctc       540
     cagctgcgcc gcgtcgtcga gctcgccggc atgctcgacc gctgcgactt cgaggagcag       600
     gcgacggtcg agggagacga gggacggctg cgaccggacc tcgtcgtgcg cctgcccggt       660
     ggacggaacg tcgtggtgga cgcgaaggcg ccgctctccg cctacctcga ggcgatcgaa       720
     gcccgcgacg acggcgagcg gcgcgcccgc ctcgctgatc acgcgcggca gctccgggag       780
     cacgtgcagc agctgggcag gaaggcgtac tgggagcggc tgcgcccggc gccggagttc       840
     gcggtcctgt tcctgccggg cgagagcttc tacgcggcgg cgctggaggc ggacccgacg       900
     ctcctcgagg cgagcgccga gcggcaggtg atcgtcgcga ccccgaccac cctcatcgcg       960
     ctcctgaagg cggtggccca cggctggcgc caggcggagg tcgccgagaa cgccgaggcg      1020
     gtcgccgcgc tcggccgcga gctctacaag cgcatcgcgg acctcggcgg gcacttcgcg      1080
     cggctcggcc gtgcgctcgg cggcaccgtc gaggcgtaca accgggcggt gggctcgctc      1140
     gaggcgcgcg tcctccccgc tgcgcggcgg ttcgaggccc tgtcggccgc ccccgcggag      1200
     gcggagctgc ccgagctcgc tccgctcgac ctcgtgccgc gcgacgtcgt agcccccgag      1260
     ctcgcagacc cgttcgcggc gcgctga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page