(data stored in ACNUC7421 zone)

EMBL: CP000769.PE527

CP000769.PE527       Location/Qualifiers
FT   CDS_pept        complement(607018..607581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0533"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   ade:Adeh_0488 protein of unknown function UPF0016"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24747"
FT                   /db_xref="GOA:A7H7Q1"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7Q1"
FT                   /protein_id="ABS24747.1"
FT                   /translation="MTPILSSFLLVAVSEMGDKTQLLAFSLATRFRKPWPVMAGILVAT
FT                   IANHALASSVGAWISANVPARALAGFLAVTFIGFGVWTLRPDTLDEARGPERFGAFVTT
FT                   TILFFLAEMGDKTQLATVALAARYESIVRVTVGTTLGMLAADGLAVFLGEKVADQVSSR
FT                   KMRWAAASLFFVFGALSLVASLRA"
     atgaccccca tcctcagctc cttcctgctg gtcgccgtga gcgagatggg ggacaagacc        60
     cagctcctcg cgttctcgct cgcgacgcgc ttccggaagc cgtggccggt gatggcgggc       120
     atcctcgtcg ccacgatcgc gaaccacgcc ctcgcgtcgt cggtcggcgc ctggatctcg       180
     gcgaacgtcc ccgcccgcgc gctcgcgggg ttcctcgcgg tcacgttcat cggcttcggc       240
     gtctggacgc tccggccgga cacgctcgac gaggcccgcg gaccggagcg cttcggcgcg       300
     ttcgtcacca ccacgatcct gttcttcctg gcggagatgg gcgacaagac ccagctcgcg       360
     acggtcgccc tcgccgcgcg ctacgagtcg atcgtccgcg tgaccgtcgg gacgacgctg       420
     ggcatgctgg cggcggacgg cctcgccgtg ttcctgggcg agaaggtcgc ggaccaggtc       480
     tcctcgcgca agatgcgctg ggcggccgcc tcgctgttct tcgtgttcgg cgcgctgtcc       540
     ctggtggcct ccctccgcgc ttga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page