(data stored in ACNUC7421 zone)

EMBL: CP000769.PE528

CP000769.PE528       Location/Qualifiers
FT   CDS_pept        607770..608591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24748"
FT                   /db_xref="GOA:A7H7Q2"
FT                   /db_xref="InterPro:IPR025576"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7Q2"
FT                   /protein_id="ABS24748.1"
FT                   /translation="MTSTATAQRTTDRPTAAPPRSMLPHEHGAWGQLAMPLLTALAIGR
FT                   PGLAPTALAAGVVLAFIAHEPLLVLLGQRGRRVAEEEGPRARRWLLATGGLAAASGLLG
FT                   IALAPAAARLALALPAALAAVVALLVWRRLEKTTLGEIVVAAALASAGWAVALAGHAPA
FT                   EAALTAALAWIIAFAAATLGVRVILARARSKGARDPGKLHAVLSAALAGVAVALSAAGL
FT                   PAALAWATLPPALLSIVICLARFSPKRLKPLGWAIVASSAVTLVILVAGLR"
     gtgacctcga ccgcgaccgc tcagcgtacg accgaccgcc ccaccgccgc cccgccccgc        60
     tcgatgctgc cgcacgagca cggcgcctgg gggcagctcg ccatgccgct cctgacggcg       120
     ctcgccatcg gccggcccgg gctggcgccc acggcgctgg ccgcgggggt ggtgctcgcg       180
     ttcatcgcgc acgagccgct cctcgtgctg ctcggccagc gaggccggcg cgtcgcggag       240
     gaggaaggac cgcgcgcgcg gcggtggctg ctcgccaccg gcggcctcgc cgcggcgagc       300
     gggctgctcg ggatcgcgct cgcgcccgcg gcggcgcggc tcgccctcgc gctgcccgcg       360
     gcgctcgcgg ccgtcgtggc gctcctcgtc tggcgccggc tcgagaagac gacgctcggc       420
     gagatcgtgg tggccgccgc gctcgcgtcg gccggctggg ccgtcgccct cgccggccac       480
     gcgcccgcgg aggcggccct cacggcggcg ctcgcgtgga tcatcgcctt cgccgccgcc       540
     acgctggggg tgcgcgtcat cctcgcgcgc gcgcgatcga agggcgcgcg cgatcccggg       600
     aagctgcacg ccgtcctctc ggccgccctc gccggggtcg cggtggcgct ctccgccgcc       660
     ggcctcccgg cggcgctcgc ctgggcgacg ctcccccccg cgctcctctc gatcgtcatc       720
     tgcctggcgc gcttctcgcc gaagcggctg aagccgctcg ggtgggcgat cgtcgcgtcc       780
     tccgcggtga cgctcgtgat cctcgtcgcg gggctgcggt ag                          822
//

If you have problems or comments...

PBIL Back to PBIL home page