(data stored in ACNUC7421 zone)

EMBL: CP000769.PE530

CP000769.PE530       Location/Qualifiers
FT   CDS_pept        complement(611031..611786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0536"
FT                   /product="P pilus assembly protein chaperone PapD-like
FT                   protein"
FT                   /note="KEGG: ade:Adeh_3600 P pilus assembly protein
FT                   chaperone PapD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24750"
FT                   /db_xref="GOA:A7H7Q4"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7Q4"
FT                   /protein_id="ABS24750.1"
FT                   /translation="MRPLRRAARALRVLLAAAALAPAAASGGDLDVSPVNVELSGKVRT
FT                   ALLSLRNGDGAAARYQLRAYGWAQKPDGAMDLTPSRELVVFPPLLELAPGEARNVRIGT
FT                   DAAPAGTERTWRLFIEELPRAEAAEDAARVEVLTRVGVPVFLAPAAPVERGELALLGRD
FT                   GARIRLALRNTGTVRLRPRSVRLALVAADGTSVLERSLDVWYVLAGGERVYEVDVPAEA
FT                   CARAAAVVATAALERGVLEARAAGACRDP"
     atgcgaccgc tccgccgagc cgcccgcgcc ctccgcgtcc tcctcgccgc cgccgcgctc        60
     gcgcccgccg ccgcgagcgg cggcgacctc gacgtctcgc cggtgaacgt ggagctgtcc       120
     ggcaaggtcc gcaccgcgct cctgtcgctg cgcaacggcg acggcgcggc cgcgcggtac       180
     cagctccgcg cgtacggctg ggcgcagaag ccggacggcg cgatggacct cacccccagc       240
     cgcgagctcg tcgtcttccc gcccctcctc gagctcgcgc ccggcgaggc gcggaacgtc       300
     cgcatcggca ccgacgccgc gcccgccggg acggagcgca cctggcgcct cttcatcgag       360
     gagctcccgc gcgccgaggc cgcggaggat gcggcgcggg tcgaggtgct cacgcgcgtc       420
     ggggtcccgg tcttcctcgc ccccgccgcc ccggtggagc gcggcgagct cgcgctcctg       480
     ggccgcgacg gggcgcgcat ccggctcgcc ctgcggaaca cgggcacggt ccggctgcgc       540
     ccgcggagcg tgcggctcgc gctcgtcgcc gccgacggga cgagcgtgct cgagcggtcg       600
     ctggacgtct ggtacgtgct cgccggcggc gagcgcgtct acgaggtcga cgtgccggcg       660
     gaggcgtgcg cgcgcgccgc cgccgtcgtc gcgaccgccg cgctcgagcg cggcgtgctc       720
     gaggcgcgcg ccgcgggcgc gtgccgtgac ccgtaa                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page