(data stored in ACNUC7421 zone)

EMBL: CP000769.PE533

CP000769.PE533       Location/Qualifiers
FT   CDS_pept        613058..615508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0539"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; GAF domain
FT                   protein; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ade:Adeh_2956
FT                   periplasmic sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24753"
FT                   /db_xref="GOA:A7H7Q7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7Q7"
FT                   /protein_id="ABS24753.1"
FT                   /translation="MDRWWDLKRSAAPRRPGTTLSPVGALLYGKFPIYLTPVRGPPRER
FT                   ARARPHPDIPNAMESSHPSPAPRPEGERAGPEARGGERNAAAPRDERPAPSRPEGERAV
FT                   SIGEAQPVDVLAVDDDPRNLEATRALLSGSGARIVEARSAEEALRILLTREVALILLDV
FT                   GLPGMSGLEMAKLVRARERTRHTPIIILTASSDPRLLERGYALGAVDFLTTPVPEQALR
FT                   AKVAFFIEAHRKNEALRHNAELLRAAQERELARNVAEARRRWEEEALRREMERDRRLVD
FT                   TLHRANERLKLLSSVRSDLLTAQVVRERLPAICDRVAAHLGLERWSLHLADPDGRLSLA
FT                   ATGGADGAQVARARALDSVEAILGGTAARVAARGEPVPPIGEALGVVCCAARPLHTGDR
FT                   VLAAFAFGSAERDACDPDDPATLELVGYAMAMALERDRLIAELQGRNAELREADRRKDQ
FT                   FLAMLAHELRNPLAPVTNAVRLLQDYGADAHVRERALAAAERQVRHMARLVDDLLEVSR
FT                   VRSGKVCLRKETVELARVVREAVQSVDELVASRGHALALELPDAPLLVEGDAVRLTQVV
FT                   ENLLTNAVKYTDPGGHLRVELRREGREAVLAVRDDGIGIAPELQDTIFELFVQAEQGVD
FT                   RSRGGLGIGLSLVKTLVDMHGGAVGVTSAGPGQGSTFTVRLPALAEDTAVPAAPEPARP
FT                   ARGRRPRDILVIEDNPDIRETLAELLRRRGHAVREAEGGRAALELARDLAPEVALVDIG
FT                   LPELDGFEVAQRLREVAPEVRLVALTGYGRAEDRRRGAAAGFLAHLVKPVDIDELSAVI
FT                   DSLD"
     gtggatcgat ggtgggacct caaacgatct gccgcgccga ggcgccccgg gaccaccctg        60
     tccccggtcg gggcacttct ctacggcaag ttcccgatct atttgacccc cgtgcgcggc       120
     ccccctcgcg agcgtgcgcg cgcgcgcccc cacccggata tcccgaacgc gatggaaagc       180
     tcccacccct cgcctgcgcc ccgaccggaa ggggaacgag ccggtcccga ggcgagaggg       240
     ggcgagcgga acgccgcggc gccgcgcgac gagcggccgg cgccgtcgcg gcccgagggg       300
     gagcgcgcgg tgtccatcgg cgaggcccag ccggtcgacg tcctggcggt ggacgacgac       360
     ccgcggaacc tcgaggcgac gcgggcgctc ctctccggct cgggcgcccg gatcgtggag       420
     gcccgctccg cggaggaggc cctccgcatc ctcctcacgc gcgaggtcgc gctcatcctc       480
     ctcgacgtcg ggctccctgg catgtccggg ctcgagatgg cgaagctcgt ccgcgcgcgc       540
     gagcgcacgc gccacacccc catcatcatc ctgaccgcga gctccgaccc ccggctgctc       600
     gagcgcggct acgccctcgg cgcggtggac ttcctcacga cgcccgtccc cgagcaggcg       660
     ctgcgcgcga aggtcgcctt cttcatcgag gcgcaccgca agaacgaggc gctgcgccac       720
     aacgcggagc tcctgcgcgc cgcgcaggag cgcgagctcg cccggaacgt ggcggaggcg       780
     cggcggcgct gggaggagga ggcgctccgg cgcgagatgg agcgggatcg gcggctcgtc       840
     gacaccctgc accgggcgaa cgagcggctc aagctcctct cgagcgtccg cagcgacctg       900
     ctcaccgccc aggtcgtgcg ggagcggctc ccggccatct gcgatcgcgt ggcggcgcac       960
     ctcggcctgg agcgctggtc gctgcacctc gccgacccgg acgggcggct gtcgctcgcc      1020
     gccaccggag gcgcggacgg cgcgcaggtg gcgcgcgcga gggccctcga cagcgtcgag      1080
     gcgatcctcg gcgggacggc ggcgcgcgtc gcggcgcgcg gcgagcccgt gccccccatc      1140
     ggcgaggcgc tcggcgtggt ctgctgcgcc gcgcggccgc tgcacacggg ggaccgggtc      1200
     ctcgcggcgt tcgccttcgg ctcggccgag cgcgacgctt gcgaccccga cgaccccgcc      1260
     acgctcgagc tcgtcggcta cgcgatggcg atggcgctgg agcgcgaccg gctcatcgcc      1320
     gagctccagg gacgcaacgc ggagctgcgc gaggcggacc gtcgcaagga ccagttcctc      1380
     gccatgctcg cgcacgagct gcgcaacccg ctcgcgccgg tgaccaacgc cgtgcgcctc      1440
     ctccaggact acggcgcgga cgcgcacgtc cgcgagcggg cgctcgcggc ggcggagcgg      1500
     caggtgaggc acatggcgcg cctcgtggac gacctcctcg aggtgtcgcg cgtccgcagc      1560
     ggcaaggtgt gcctgcgcaa ggagaccgtg gagctggcgc gggtggtgcg cgaggcggtg      1620
     cagagcgtgg acgagctcgt cgcctcgcgc gggcacgcgc tcgcgctgga gctgccggac      1680
     gcgcccctgc tcgtcgaggg cgacgccgtc cgcctcacgc aggtcgtcga gaacctcctc      1740
     accaacgcgg tcaagtacac cgatcccggc ggccacctgc gcgtcgagct ccggcgcgag      1800
     gggcgcgagg cggtgctcgc ggtgcgggac gacggcatcg ggatcgcacc cgagctccag      1860
     gacaccatct tcgagctgtt cgtgcaggcg gagcagggcg tcgatcgctc gcgcggcggc      1920
     ctcggcatcg ggctctccct cgtgaagacc ctggtggaca tgcacggcgg cgccgtcggc      1980
     gtgacgagcg ccgggcccgg gcagggctcc accttcaccg tgcggctccc cgcgctcgcc      2040
     gaggacaccg ccgtgccggc ggcgccggag cccgcccgcc cggcgcgcgg gcggcgcccg      2100
     cgcgacatcc tggtgatcga ggacaacccc gacatccgcg agacgctcgc ggagctgctg      2160
     cgccggcgcg gccacgcggt gcgcgaggcg gagggcgggc gcgcggcgct cgagctcgcc      2220
     cgcgacctcg cccccgaggt cgcgctcgtg gacatcgggc tgcccgagct ggacggcttc      2280
     gaggtcgccc agcggctgcg cgaggtggcg ccggaggtcc gcctcgtggc gctcaccggc      2340
     tacgggcggg ccgaggaccg gcgccgcggc gccgcggccg gcttcctcgc ccacctcgtg      2400
     aagcccgtgg acatcgacga gctctccgca gtcatcgact cgctggactg a               2451
//

If you have problems or comments...

PBIL Back to PBIL home page