(data stored in ACNUC7421 zone)

EMBL: CP000769.PE534

CP000769.PE534       Location/Qualifiers
FT   CDS_pept        615526..620976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0540"
FT                   /product="GAF sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; GAF domain
FT                   protein; ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: mxa:MXAN_0712 sensor
FT                   histidine kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24754"
FT                   /db_xref="GOA:A7H7Q8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7Q8"
FT                   /protein_id="ABS24754.1"
FT                   /translation="MPAKPTTALDAGQLLAVLDAVRKGDFAARMPVDRTGVAGKVCDAL
FT                   NEIVELNAGLAAELARLNRVVGKEGKTSHRGRLAGAKGSWAECVDSVNGLIADLVQPSV
FT                   EVTRVIGAVARGDLGQAMALEIDGRPLQGEFLRTAGIVNTMVAQLSSFASEVTRVAREV
FT                   GTEGKLGGQAVVKGVSGTWKDLTDNVNSMASNLTAQVRAIAEVTTAVANGDLSRKITVD
FT                   VRGEILELKNTINVMVDQLSSFASEVTRVAREVGTEGKLGGQAVVKGVSGTWKDLTDNV
FT                   NSMASNLTAQVRSIAEVTTAVANGDLSKKITVDVKGEILELKNTINVMVDQLSSFASEV
FT                   TRVAREVGTEGKLGGQAVVKGVSGTWKDLTDNVNSMASNLTAQVRAIAEVTTAVATGDL
FT                   SKKITVDVKGEILELKNTINTMVDQLSSFASEVTRVAREVGTEGKLGGQAVVKGVAGTW
FT                   KDLTDNVNSMASNLTVQLRDVSKVATAIANGDLGQKITVAVQGEILQIKDVINKMVDQL
FT                   SSFASEVTRVAREVGTEGKLGGQADVRGVAGTWKDLTDSVNSMASGLTAQVRDIAKVAT
FT                   AVANGDLSQKIAVDVRGEILELKNTINGMVDNLRTFSTEVTRVAREVGTEGKLGGQAVV
FT                   KGVAGTWKDLTDNVNSMASNLTTQVRAIAEVTTAVANGDLSRKIAVDVRGEILELKNTI
FT                   NVMVDQLSSFASEVTRVAREVGTEGKLGGQADVKGVSGTWKDLTDNVNSMASNLTSQVR
FT                   NIAAVTTAVATGDLTKKITVDVRGEMLELKNTINVMVDQLSSFASEVTRVAREVGTEGK
FT                   LGGQADVKGVSGTWKDLTDNVNWMASNLTAQVRGIATVVTAVAAGDLGRKLALEAKGEI
FT                   AALADTINGMIDTLATFADQVTNVAREVGTEGKLGGQARVPGAAGVWRDLTDNVNSLAA
FT                   NLTTQVRAIAEVATAVTKGDLTRSIAVGAQGEVAALKDNINQMISNLRATTQKNTEQDW
FT                   LKTNLARFTRMLQGQRDLEAVGKLILKELAPLVEAQMGVFYLLEEQGGERVLQLLSSFA
FT                   FRERKGLSNRFKPGEGLVGQCVLEKDRILVTDLPEDYTPISSGLGEGKPRSVVVLPILF
FT                   EGEVKAVIELASFHRFGEIHLAFLDQLTESIGIVLNTIAASMRTEELLKQSQSLAEELR
FT                   AQQAELTDSNRRLEQQANSLQASEDRLRNQQEELQRTNEELEERSRLLEVQNVEVERKN
FT                   REIEQAKAALEERAQQLAVASKYKSEFLANMSHELRTPLNSMLVLSKLLSDNADGNLSP
FT                   KQVDFAQTIHSAGADLLALINDILDLSKIESGAMQVDVSECLLAGLQDYIERAFRQLAS
FT                   QKGLRFAVEVDRRTPGAIWTDERRLQQIVRNLLSNAFKFTEHGEVVVRIAPARGGWSRD
FT                   AEGLNAAGSVLALSVRDTGIGIAPEKQRIIFEAFQQADGTTSRKYGGTGLGLSISRELA
FT                   KLLGGELAVESSPGKGSTFTLYLPEARLAVPAAPPNVAVAVPRAASRDGLPPAVPAGAE
FT                   ATSGLQPPASPGLAASVEPLAAKGILVVVPDARLAATVEAVARDRGFAVWQADASDAVR
FT                   TARERRPDGIVIEVGAAAGPEWSVLERLKEDHDTREIPLHVLAAPAPAAEEMAAAGDGA
FT                   SAPPPARAAGEHAADEVALFLHRVDAELPERKRALVRAATADTSLVSKKILIVDDDVRN
FT                   VFAITALLEQHGASVVYAENGRRGLEVLKANPGVDLVLMDVMMPELDGYETMRAIRHLP
FT                   EFERLPIIALTAKAMKGDREKCVESGASDYVTKPVKAEQILSLLRVWLYRRPEPRGEAR
FT                   V"
     atgcccgcca agccgaccac ggcgctcgac gccggccagc tcctcgccgt cctggacgcc        60
     gtccgcaagg gcgacttcgc cgcgcgcatg ccggtcgacc gcaccggcgt cgcgggcaag       120
     gtctgcgacg ccctcaacga gatcgtcgag ctcaacgccg ggctcgccgc cgagctcgcg       180
     cggctgaacc gcgtggtcgg caaggagggg aagacctcgc accgcggccg cctggcgggg       240
     gcgaagggct cgtgggccga gtgcgtggac tcggtgaacg gcctcatcgc cgacctcgtc       300
     cagcccagcg tcgaggtgac gcgcgtcatc ggcgcggtcg cgcgcggcga tctcggtcag       360
     gcgatggcgc tcgagatcga cgggcggccg ctccagggag agttcctccg caccgccggc       420
     atcgtgaaca ccatggtggc ccagctctcc tcgttcgcga gcgaggtgac gcgggtcgcg       480
     cgcgaggtgg gcacggaggg gaagctcggc gggcaggcgg tggtgaaggg cgtgtcgggc       540
     acctggaagg acctcaccga caacgtgaac tcgatggcgt cgaacctcac cgcgcaggtg       600
     cgcgccatcg ccgaggtgac gaccgcggtc gcgaacggcg acctctcccg caagatcacc       660
     gtcgacgtgc gcggcgagat cctcgagctg aagaacacca tcaacgtgat ggtcgatcag       720
     ctctcctcgt tcgcgagcga ggtgacgcgg gtcgcgcgcg aggtgggcac ggaggggaag       780
     ctcggcgggc aggcggtggt gaagggcgtg tcgggcacct ggaaggacct caccgacaac       840
     gtgaactcga tggcgtcgaa cctcaccgcc caggtgcgca gcatcgcgga ggtcacgacg       900
     gccgtcgcga acggcgacct gtcgaagaag atcacggtgg acgtgaaggg ggagatcctc       960
     gagctgaaga acaccatcaa cgtgatggtc gatcagctct cctcgttcgc gagcgaggtg      1020
     acgcgggtcg cgcgcgaggt gggcacggag gggaagctcg gcgggcaggc ggtggtgaag      1080
     ggcgtgtcgg gcacctggaa ggacctcacc gacaacgtga actcgatggc gtcgaacctc      1140
     accgcgcagg tgcgcgccat cgccgaggtg acgaccgcgg tcgccacggg cgacctgtcg      1200
     aagaagatca cggtggacgt gaagggggag atcctcgagc tcaagaacac catcaacacg      1260
     atggtggatc agctctcctc cttcgcgagc gaggtgacgc gggtcgcgcg cgaggtgggc      1320
     acggagggga agctcggcgg ccaggcggtg gtgaaggggg tcgccggcac ctggaaggac      1380
     ctcaccgaca acgtgaactc gatggcgtcg aacctcaccg tccagctgcg ggacgtgtcg      1440
     aaggtggcga ccgccatcgc gaacggcgac ctcggccaga agatcaccgt cgccgtgcag      1500
     ggcgagatcc tccagatcaa ggacgtcatc aacaagatgg tggaccagct ctcctcgttc      1560
     gcgagcgagg tgacgcgggt cgcgcgcgag gtgggcacgg aggggaagct cgggggccag      1620
     gccgacgtgc ggggcgtggc cggcacctgg aaggacctca ccgacagcgt caactcgatg      1680
     gcgtcgggcc tcaccgcgca ggtgcgggac atcgccaagg tcgcgacggc cgtcgcgaac      1740
     ggcgacctgt cccagaagat cgcggtggac gtccgcgggg agatcctcga gctgaagaac      1800
     accatcaacg gcatggtgga caacctgcgc accttctcga cggaggtgac gcgggtggcg      1860
     cgcgaggtgg gcacggaggg gaagctcggc ggccaggcgg tcgtgaaggg cgtcgccggc      1920
     acgtggaagg acctcaccga caacgtgaac tcgatggcgt cgaacctcac cacccaggtg      1980
     cgcgccatcg ccgaggtgac caccgcggtc gcgaacggcg acctgtcccg caagatcgcc      2040
     gtcgacgtgc gcggggagat cctcgagctg aagaacacca tcaacgtgat ggtggaccag      2100
     ctctcctcgt tcgcgagcga ggtgacgcgc gtggcgcgcg aggtgggcac ggaggggaag      2160
     ctcggcgggc aggccgacgt gaagggcgtg tcgggcacct ggaaggacct caccgacaac      2220
     gtgaactcga tggcgtcgaa cctgacgtcc caggtgcgca acatcgccgc cgtgaccacc      2280
     gccgtcgcca ccggcgatct cacgaagaag atcacggtgg acgtccgcgg cgagatgctc      2340
     gagctgaaga acaccatcaa cgtgatggtg gaccagctct cctcgttcgc gagcgaggtg      2400
     acgcgcgtgg cgcgcgaggt gggcacggag gggaagctcg gcgggcaggc cgacgtgaag      2460
     ggcgtgtcgg gcacctggaa ggacctcacc gacaacgtga actggatggc gtcgaacctc      2520
     accgcgcagg tgcggggcat cgccaccgtg gtcaccgccg tcgccgccgg cgacctgggc      2580
     cgcaagctcg ccctcgaggc gaagggcgag atcgccgccc tggccgacac catcaacggg      2640
     atgatcgaca ccctggcgac cttcgcggat caggtgacga acgtcgcgcg cgaggtgggc      2700
     acggagggca agctgggcgg ccaggcgcgg gtgcccgggg ccgcgggcgt ctggcgcgac      2760
     ctcaccgaca acgtgaactc gctcgccgcg aacctcacga cgcaggtgcg cgccatcgcg      2820
     gaggtcgcca ccgcggtgac gaagggggac ctcacccggt ccatcgcggt gggggcgcag      2880
     ggcgaggtcg ccgccctgaa ggacaacatc aaccagatga tctccaacct gcgcgcgacc      2940
     acgcagaaga acaccgagca ggactggctg aagacgaacc tcgcccgctt cacccgcatg      3000
     ctgcaggggc agcgcgacct cgaggcggtc ggcaagctca tcctgaagga gctcgcgccg      3060
     ctggtggagg cgcagatggg cgtgttctac ctcctcgagg agcagggcgg cgagcgggtg      3120
     ctgcagctcc tctcgtcgtt cgcgttccgc gagcggaagg gcctgtccaa ccggttcaag      3180
     ccgggggagg ggctcgtcgg gcagtgcgtg ctggagaagg atcgcatcct cgtcaccgac      3240
     ctgcccgagg actacacgcc catctcctcc ggcctggggg agggcaagcc gcgcagcgtc      3300
     gtcgtgctgc ccatcctgtt cgagggcgag gtgaaggcgg tcatcgagct cgcctcgttc      3360
     caccgcttcg gcgagatcca cctcgcgttc ctggaccagc tcaccgagtc gatcggcatc      3420
     gtgctcaaca cgatcgcggc gagcatgcgc accgaggagc tcctgaagca gtcgcagtcg      3480
     ctcgcggagg agctgcgcgc ccagcaggcg gagctcaccg actcgaaccg ccggctggag      3540
     cagcaggcga actcgctgca ggcctcggag gaccgcctcc gcaaccagca ggaggagctg      3600
     cagcgcacga acgaggagct cgaggagcgc tcgcggctgc tggaggtgca gaacgtcgag      3660
     gtggagcgca agaaccgcga gatcgagcag gcgaaggcgg cgctggagga gcgcgcccag      3720
     cagctcgccg tcgcctcgaa gtacaagtcc gagttcctcg ccaacatgtc gcacgagctg      3780
     cgcacgccgc tgaactcgat gctggtgctc tcgaagctcc tctccgacaa cgccgacggg      3840
     aacctctcgc cgaagcaggt ggacttcgcc cagaccatcc actccgccgg cgcggacctc      3900
     ctcgccctca tcaacgacat cctcgacctg tccaagatcg agtcgggcgc gatgcaggtg      3960
     gacgtgtcgg agtgcctgct cgccggcctg caggactaca tcgagcgggc gttccggcag      4020
     ctggccagcc agaagggcct gcgcttcgcg gtggaggtgg atcgccgcac gccgggcgcg      4080
     atctggaccg acgagcggcg cctccagcag atcgtgcgga acctcctgtc gaacgccttc      4140
     aagttcaccg agcacggcga ggtggtggtg cggatcgccc cggcgcgcgg cggctggagc      4200
     cgggacgccg aggggctgaa cgcggcgggc tcggtgctcg cgctctccgt gcgcgacacg      4260
     ggcatcggca tcgcgcccga gaagcagcgc atcatcttcg aggcgttcca gcaggcggac      4320
     ggcacgacga gccgcaagta cggcggcacc gggctcgggc tctccatcag ccgcgagctc      4380
     gcgaagctcc tcggcggcga gctcgccgtc gagtcctcgc ccggcaaggg gagcaccttc      4440
     acgctgtacc tgccggaggc gcgcctcgcc gtgccggccg cgccgcccaa cgtggcggtg      4500
     gcggtcccgc gcgcggcgag ccgcgacggc ctgccgcccg ccgtgccggc cggggcggag      4560
     gcgacctccg gcctgcagcc gcccgcctcc ccggggttgg ccgcgagcgt ggagccgctc      4620
     gccgcgaagg ggatcctggt ggtcgtgccc gacgcgcggc tcgccgcgac cgtggaggcc      4680
     gtggcgcgcg accgcggctt cgcggtctgg caggcggacg cctccgacgc ggtgcgcacc      4740
     gcgcgcgagc ggcggccgga cggcatcgtg atcgaggtcg gcgcggcggc ggggcccgag      4800
     tggtccgtgc tcgagcggct caaggaggac cacgacacgc gcgagatccc cctgcacgtg      4860
     ctcgcggcgc cggcgccggc ggcggaggag atggccgcgg ccggcgacgg cgcctccgcc      4920
     ccgccgcccg cgcgggcggc cggcgagcac gccgccgacg aggtggcgct gttcctccac      4980
     cgcgtggacg ccgagctccc ggagcgcaag cgcgcgctcg tgcgggccgc cacggcggac      5040
     acctcgctcg tgtcgaagaa gatcctcatc gtggacgacg acgtgcggaa cgtgttcgcc      5100
     atcacggcgc tcctcgagca gcacggggcg agcgtcgtct acgcggagaa cgggcggcgc      5160
     gggctcgagg tgctgaaggc caacccgggg gtggacctcg tcctcatgga cgtgatgatg      5220
     ccggagctgg acgggtacga gacgatgcgc gccatccgcc acctgcccga gttcgagcgc      5280
     ctgccgatca tcgcgctcac cgccaaggcg atgaaggggg accgcgagaa gtgcgtcgag      5340
     tccggcgcct ccgactacgt gacgaagccg gtgaaggccg agcagatcct gtcgctgctg      5400
     cgggtgtggc tgtaccgccg gccggagccg cgcggggagg cgcgcgtctg a               5451
//

If you have problems or comments...

PBIL Back to PBIL home page