(data stored in ACNUC7421 zone)

EMBL: CP000769.PE539

CP000769.PE539       Location/Qualifiers
FT   CDS_pept        624243..625250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0545"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG:
FT                   ade:Adeh_0200 cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24759"
FT                   /db_xref="GOA:A7H7R3"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7R3"
FT                   /protein_id="ABS24759.1"
FT                   /translation="MPTRAVAERRARWFVCRMRAFTRFAWAVLGYNLLVVAWGAFVRAT
FT                   GSGAGCGKHWPMCNGAVVPRAPAVETVIEFTHRATSGIALLLVVALVAWAVRAFPGGHP
FT                   ARKAAWASLGLMILEALVGAGLVLFGWVAKDTSFARGWVMGVHLTNTFLLLGALTLTAD
FT                   WSARPGGMRFGERGVVAGALWLAFVTVILAGVTGAIAALGDTLFPTTSFAEGLRQELST
FT                   EAHVLLRLRILHPFAAVAAAAVLLLVARMALRHRPDPRVRRAALSLLLLVAIELLAGAV
FT                   NVLLLAPVWLQLVHLLLADLVFVSLVLLAAASLAPGEVEVPAGTPGPLPASLQS"
     atgccgaccc gcgccgttgc ggagcggcgg gcgcggtggt ttgtctgccg catgcgcgcg        60
     ttcacccgct tcgcctgggc ggtgctcggc tacaacctgc tcgtcgtcgc gtggggcgcc       120
     ttcgtccgcg ccaccggctc gggcgcgggc tgcggcaagc actggccgat gtgcaacggg       180
     gcggtggtgc cccgggcgcc ggcggtcgag accgtcatcg aattcacgca tcgtgccacg       240
     agcggcatcg ccctcctgct cgtcgtggcg ctggtggcgt gggccgtccg cgcgttcccg       300
     ggcggtcatc cggcgcggaa ggcggcgtgg gcgtcgctcg ggctcatgat cctcgaggcg       360
     ctggtgggcg ccgggctcgt cctcttcggc tgggtggcga aggacacctc gttcgcccgc       420
     ggctgggtga tgggcgtcca cctcacgaac accttcctcc tcctcggcgc cctcaccctc       480
     accgccgact ggagcgcgcg gccaggcggc atgcgcttcg gcgagcgcgg cgtcgtcgcc       540
     ggcgcgctct ggctcgcctt cgtgacggtg atcctcgccg gcgtcaccgg cgcgatcgcc       600
     gcgctgggcg acacgctctt cccgacgacg agcttcgccg aggggctgcg ccaggagctc       660
     tcgaccgagg cgcacgtgct cctccgcctc cgcatcctgc acccgttcgc cgccgtcgcg       720
     gcggccgcgg tgctgctgct cgtggcgcgc atggcgctgc gacatcggcc cgatccgcgc       780
     gtgcgccgcg ccgccctgtc cctcctgctg ctcgtcgcga tcgagctcct ggcgggcgcg       840
     gtcaacgtgc tgctgctcgc gccggtgtgg ctgcagctcg tccacctgct gctggcggat       900
     ctggtcttcg tgtcgctcgt gctcctcgcg gcggcgagcc tcgcccccgg tgaggtggag       960
     gtcccggcgg ggacgcccgg ccccctgccg gccagccttc agagctag                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page