(data stored in ACNUC7421 zone)

EMBL: CP000769.PE541

CP000769.PE541       Location/Qualifiers
FT   CDS_pept        626308..627264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_3496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24761"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7R5"
FT                   /protein_id="ABS24761.1"
FT                   /translation="MRDHIAWPELPLARWRGTCETLHMWTQVIGKVRLASTPLVNHWWN
FT                   VPLYPTARGLTTSLMFHGPTGFEIALDLLDHQLEVTTSDGTFGAMPLVPQTVAQFHARL
FT                   MGMLRDLAIDVPIRTTPVEIPNPIPFEKDDVHASYDAEWAQRFWRVLLASSRVLGEFRA
FT                   RFIGKASPVHFFWGSFDLAVTLFSGRRAPERPGADGITREAYSHEVVSFGFWPGGGVMD
FT                   DAAFYAYAAPEPAAFADAPVRPAEAHYHRALREFILPYAAVRADAEPERRLMEFLETTY
FT                   EAATELGGWDRAALERGEPAAVEAAPRGERPEAPPLH"
     atgcgcgatc acatcgcctg gccggagctg ccgctggcgc gctggcgtgg cacctgcgag        60
     acgctgcaca tgtggacgca ggtcatcggc aaggtgcgcc tcgcctcgac gccgctcgtg       120
     aaccactggt ggaacgtgcc gctctacccg acggcgcgcg ggctcaccac ctcgctcatg       180
     ttccacgggc ccacgggctt cgagatcgcg ctcgacctcc tcgaccacca gctcgaggtc       240
     accaccagcg acgggacgtt cggggcgatg ccgctcgtcc cgcagacggt cgcgcagttc       300
     cacgcgcgtc tcatggggat gctgcgcgac ctcgcgatcg acgtgcccat ccgcacgacg       360
     ccggtggaga tcccgaaccc gatcccgttc gagaaggacg acgtgcacgc ctcctacgac       420
     gcggagtggg cgcagcgctt ctggcgggtg ctgctcgcct cgagccgggt gctcggggag       480
     ttccgggctc gcttcatcgg caaggcgagc ccggtccact tcttctgggg cagcttcgat       540
     ctcgcggtca cgctcttctc cgggcgccgc gcgccggagc ggccgggggc ggacggcatc       600
     acgcgcgagg cctactcgca cgaggtggtg tccttcggct tctggccggg cggaggcgtg       660
     atggacgacg ccgccttcta cgcgtacgcc gcgccggagc cggccgcgtt cgccgacgcc       720
     ccggtgcgcc ccgcggaagc ccactaccat cgggcgctgc gcgagttcat cctgccctac       780
     gccgccgtcc gcgccgacgc ggagccggag cggcgcctca tggagttcct cgagacgacc       840
     tacgaggcgg cgaccgagct cggcggctgg gatcgcgccg cgctcgagcg cggtgagccg       900
     gccgccgtcg aggcggcgcc gcgaggggag cggccggaag cgccgcccct gcattga          957
//

If you have problems or comments...

PBIL Back to PBIL home page