(data stored in ACNUC7421 zone)

EMBL: CP000769.PE542

CP000769.PE542       Location/Qualifiers
FT   CDS_pept        627381..627788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0548"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   KEGG: ade:Adeh_0492 hemerythrin-like, metal-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24762"
FT                   /db_xref="GOA:A7H7R6"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7R6"
FT                   /protein_id="ABS24762.1"
FT                   /translation="MVETHAWNEKLDVGHEAMDHDHHLQIGLVSAFVDAVERGRPWMAR
FT                   RLADQLLAYSVAHFGSEELLMEGSAFPERDAHAGEHGAFLEQMRELQRSFSSGDEALAT
FT                   TSALELRGALAAHMNGADRRLAAHVSPLTRG"
     atggtggaga cgcacgcctg gaacgagaag ctcgacgtcg gccacgaggc gatggatcac        60
     gatcaccacc tgcagatcgg gctcgtgagc gccttcgtgg acgcggtcga gcgcggtcgc       120
     ccgtggatgg cgcgccgtct cgcggaccag ctcctcgcct acagcgtcgc gcacttcggc       180
     agcgaggagc tgctcatgga gggcagcgcg ttccccgagc gcgacgcgca cgcgggcgag       240
     cacggcgcgt tcctcgagca gatgcgcgag ctgcagcgct cgttctcgag cggggacgag       300
     gcgctcgcca cgacctccgc gctggagctg cgcggcgcgc tcgccgcgca catgaacggc       360
     gccgatcgcc ggctcgcggc gcacgtctcg cccctcaccc gcggctga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page