(data stored in ACNUC7421 zone)

EMBL: CP000769.PE543

CP000769.PE543       Location/Qualifiers
FT   CDS_pept        627908..628924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_0488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24763"
FT                   /db_xref="GOA:A7H7R7"
FT                   /db_xref="InterPro:IPR008754"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7R7"
FT                   /protein_id="ABS24763.1"
FT                   /translation="MCPVLTGWGTLTRRNIDPYHASSRLEEASLLSNRSLLAVALAAAV
FT                   LAGCEGARTDPNLAAEDQALAASRQIRSCGTENPSARDLERVSREVDAKLRTSNAEGAA
FT                   ARAAGSVAVPVWFHVVNRGSGLANGDVPQALIDAQLRVLNDAFAGRTGGTPTAFTFTLA
FT                   GVTRTTNATWFGSCDVSSVEAQMKTALRVGGAGTLNVYSCDPGGGLLGWATFPWSYASS
FT                   PRMDGVVLLYSSLPGGGAAPYDEGDTGTHEVGHWLGLYHTFQGGCPSGDSVTDTNAERS
FT                   AAYGCPTGRDTCNGKRYPGPDPITNFMDYTDDACMFHFTSGQASRADAQAATYRPAP"
     gtgtgccccg tcctgacggg gtggggcacg ttgacccgac gcaatatcga cccctaccat        60
     gcctcctccc gactcgagga ggcgtccttg ctttcgaacc gctcgctgct cgccgtcgcg       120
     ctcgctgccg ccgtcctggc cggctgcgaa ggagcccgca ccgatcccaa cctcgcggcc       180
     gaggaccagg ccctcgcggc gagccgccag atccgcagct gcggcacgga gaacccgagc       240
     gcccgggacc tggagcgcgt ctcccgcgag gtggacgcga agctccgcac ctcgaacgcg       300
     gagggcgccg cggcgcgcgc ggcgggctcg gtcgccgtcc ccgtctggtt ccacgtggtg       360
     aaccggggat cggggctcgc gaacggggac gtgccgcagg cgctcatcga cgcgcagctg       420
     cgggtgctga acgacgcctt cgcgggccgc acgggcggca cgcccacggc gttcaccttc       480
     acgctcgcgg gcgtcacgcg cacgaccaac gccacctggt tcggctcgtg cgacgtctcg       540
     tcggtggagg cgcagatgaa gacggcgctg cgcgtcggcg gcgcggggac gctgaacgtc       600
     tacagctgcg accccggcgg cggcctcctc ggctgggcga ccttcccgtg gagctacgcc       660
     tcgagcccgc ggatggatgg ggtcgtgctc ctctactcct cgctgcccgg tggcggcgcc       720
     gccccgtacg acgagggcga caccggcacg cacgaggtcg ggcactggct cggcctctac       780
     cacacgttcc agggcgggtg cccgagcggc gacagcgtca ccgacaccaa cgccgagcgc       840
     tccgcggcgt acggttgtcc gacgggacgc gacacctgca acgggaagcg ctaccccggt       900
     cccgatccca tcacgaactt catggactac acggacgacg cctgcatgtt ccacttcacg       960
     tcgggtcaag cgtctcgcgc cgacgcgcag gcggcgacgt accggccggc gccctag         1017
//

If you have problems or comments...

PBIL Back to PBIL home page