(data stored in ACNUC7421 zone)

EMBL: CP000769.PE546

CP000769.PE546       Location/Qualifiers
FT   CDS_pept        complement(631662..632660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0552"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   ade:Adeh_2249 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24766"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7S0"
FT                   /protein_id="ABS24766.1"
FT                   /translation="MEPRVWRFVKTLLAAVAAAALLAPASPRAAYPERPITMIVPFAAG
FT                   GPTDVVARIVADDMSRTLGQQIVIENVAGAGGTTGITRASQAPPDGYTIMMGHMGTHGA
FT                   APAVYPNLKYDPVKDFAPIGLASGTPILIVARKDFPAKDLKEFMAYAKQNGSKLNEAHA
FT                   GVGSVSFSTCTVFNSLVGVKPTRVVYRGTGPALNDLVAGQVDYMCDQIPSLVPQIQAGT
FT                   IKAYAVALPERSPALPNVPTTKEAGLPEFQVSAWNAIFAPKGTPPEVTKKLNGALVKAL
FT                   KDPGTRKRLLDLGGDLSNEDAQTPEGLRKLVESEVARWSKALKGAGSAEAK"
     atggagccga gagtgtggag gttcgtgaag acgctgctcg ccgcggtggc cgccgcggcg        60
     ctgctcgcac ccgcctcgcc gcgggccgcc taccccgagc ggcccatcac catgatcgtc       120
     ccgttcgccg cgggcggtcc gacggacgtc gtcgcccgca tcgtcgccga cgacatgtcg       180
     cgcaccctcg gtcagcagat cgtgatcgag aacgtcgccg gcgcgggcgg cacgaccggc       240
     atcacgcgcg cgtcccaggc gccgccggac ggctacacca tcatgatggg ccacatgggc       300
     acgcacgggg cggcgcccgc cgtctacccc aacctcaagt acgatccggt gaaggacttc       360
     gcgcccatcg gcctcgcctc cggcacgccg atcctgatcg tcgcccgcaa ggacttcccg       420
     gcgaaggacc tgaaggagtt catggcgtac gcgaagcaga acggctcgaa gctgaacgag       480
     gcgcacgcgg gcgtgggctc cgtctccttc agcacctgca cggtcttcaa ctcgctcgtc       540
     ggcgtgaagc cgacgcgcgt ggtctaccgc ggcaccggcc ccgccttgaa cgacctggtc       600
     gccggacagg tggactacat gtgcgatcag atcccgagcc tggtgccgca gatccaggcg       660
     gggaccatca aggcgtacgc ggtggcgctg cccgagcgct ccccggcgct gccgaacgtt       720
     cccaccacca aggaggccgg cctgccggag ttccaggtga gcgcctggaa cgcgatcttc       780
     gcgcccaagg ggacgccccc cgaggtcacg aagaagctca acggcgcgct cgtgaaggcg       840
     ctcaaggatc ccggcacgcg gaagcgtctc ctcgacctcg gcggcgacct ctccaacgag       900
     gacgcccaga cgccggaggg gctgcgcaag ctcgtcgaga gcgaggtggc gcgctggtcg       960
     aaggcgctga agggcgccgg cagcgccgag gccaagtag                              999
//

If you have problems or comments...

PBIL Back to PBIL home page