(data stored in ACNUC7421 zone)

EMBL: CP000769.PE549

CP000769.PE549       Location/Qualifiers
FT   CDS_pept        635063..635698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24769"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7S3"
FT                   /protein_id="ABS24769.1"
FT                   /translation="MLLAAAAGCMPYHRARPGAETWRQGVKTVGVLPAIRILEISPGNV
FT                   EEEHEEWTEQGKRNVVAALSDGLRARGLHPKVMTWKTDDELDDVRLLYAEVAEAIWLYA
FT                   YPPYTFPHKVERFEYGVGPIGKILDRAGADVLLVAAGQDRVGSDGRKLGMLAGMRAMAL
FT                   LTLGLVDRAGNVVWFDVWGGAGIDLRQDADVRESVEKLLSELPGTAAP"
     atgctgctcg ccgcggccgc aggctgcatg ccctatcacc gcgcgcgccc cggcgccgag        60
     acctggcggc agggggtgaa gacggtgggc gtcctgcccg cgatccggat cctcgagatc       120
     tcccccggga acgtcgagga ggagcacgag gagtggacgg agcagggaaa gcggaacgtc       180
     gtcgcggcgc tctccgacgg cctgcgggcg cgagggctgc acccgaaggt gatgacctgg       240
     aagaccgacg acgagctcga cgacgtgcgg ctcctctacg ccgaggtcgc ggaggcgatc       300
     tggctctacg cctatccgcc gtacacgttc ccgcacaagg tggagcggtt cgagtacggc       360
     gtcggcccga tcggcaagat cctcgatcgg gccggcgcgg acgtgctgct cgtcgccgcg       420
     ggccaggatc gcgtcggctc ggacgggcgg aagctcggga tgctcgccgg catgcgcgcc       480
     atggcgctgc tcacgctcgg gctcgtggac cgggccggga acgtcgtctg gttcgacgtg       540
     tggggcggcg ccgggatcga cctgcggcag gacgcggacg tccgggagtc cgtcgagaag       600
     ctcctctccg agctgcccgg gacggcggcg ccgtga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page