(data stored in ACNUC7421 zone)

EMBL: CP000769.PE55

CP000769.PE55        Location/Qualifiers
FT   CDS_pept        69957..71174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0055"
FT                   /product="MltA domain protein"
FT                   /note="PFAM: MltA domain protein; 3D domain protein; KEGG:
FT                   ade:Adeh_0053 membrane-bound lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24275"
FT                   /db_xref="GOA:A7H6C9"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6C9"
FT                   /protein_id="ABS24275.1"
FT                   /translation="MPPAGPELSCAMRRALRLALAATLALAACRTVPPPPPQPATTAER
FT                   ALEELSPGAFPAFGDDLDYAGLDAALEGSLQHFARVARADPGRTLAFGKERVPVAKVAA
FT                   SLRRFRELVGARPAPAALREALRREFRVFRSIGDGRGTVLFTGYYLPEIAGSLERGGRY
FT                   QVPLHRAPVDLVQVRARDFPALSADLIGRVRDGRLVPYPTRAEIADGAIAGQGAELAWV
FT                   ASAVDAFFLEIQGSGLLRLPDGTTRVVTYAGKNGHRYEAIGAELIRRGALTREQVSMQA
FT                   IRAWLAANPAEQPLLLATNPSYVFFRFADDAIGSLGVPVTPDRTIAADARVFPKGALAF
FT                   VETERPADATGGPMKPFGRFFLDQDAGGAIKSSARVDLFLGSGAYAESAAGRMKQPGRL
FT                   YYLLLK"
     atgccgccgg ccggtcccga gttatcgtgc gcgatgcgcc gcgccctccg cctcgccctc        60
     gccgccacgc tcgcgctcgc cgcctgccgc accgtcccgc cgccgccccc gcagccggcc       120
     accaccgccg agcgggccct cgaggagctc tcgcccggcg ccttcccggc gttcggcgac       180
     gacctcgact acgcgggcct ggacgccgcc ctggagggat cgctgcagca cttcgcgcgg       240
     gtggcgcgcg ccgatcccgg ccggacgctc gccttcggga aggagcgcgt cccggtcgcg       300
     aaggtggccg cctcgctgcg gcgcttccgc gagctcgtgg gggcgcggcc cgcgccggcc       360
     gcgctgcgcg aggcgctgcg ccgcgagttc cgcgtcttcc gctcgatcgg cgacgggcgc       420
     gggacggtgc tcttcacggg ctactacctc ccggagatcg cgggctcgct cgagcgcggc       480
     ggccggtacc aggtccccct gcaccgggcc ccggtcgatc tcgtgcaggt ccgcgcgcgc       540
     gacttccccg cgctctcggc ggacctcatc ggccgggtgc gcgacggccg gctcgtgccg       600
     tatccgacgc gcgcggagat cgcggacggc gccatcgccg gccagggcgc ggagctggcg       660
     tgggtcgcct cggcggtgga cgccttcttc ctggagatcc aggggagcgg gctcttgcgc       720
     ctgccggacg ggaccacccg cgtcgtgacc tacgccggca agaacggcca ccgctacgag       780
     gcgatcggcg ccgagctgat ccgccgcggc gcgctcacgc gcgagcaggt ctcgatgcag       840
     gccatccgcg cgtggctcgc ggcgaacccg gcggagcagc cgctcctcct cgccacgaac       900
     ccgtcctacg tcttcttccg cttcgcggac gacgccatcg gctccctggg cgtgccggtc       960
     accccggatc gcaccatcgc cgccgacgcg cgcgtgttcc cgaagggcgc gctcgccttc      1020
     gtggagacgg agcgccccgc ggacgcgacg ggggggccca tgaagccgtt cggccggttc      1080
     ttcctcgacc aggacgcggg cggcgcgatc aagagctcgg cgcgcgtcga cctgttcctc      1140
     ggcagcggcg cctacgcgga gagcgcggcg ggacggatga agcagccggg gcggctctac      1200
     tacctgctcc tgaagtag                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page