(data stored in ACNUC7421 zone)

EMBL: CP000769.PE550

CP000769.PE550       Location/Qualifiers
FT   CDS_pept        635695..636849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0556"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; Tetratricopeptide TPR_2
FT                   repeat protein; KEGG: dar:Daro_0246 peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24770"
FT                   /db_xref="GOA:A7H7S4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7S4"
FT                   /protein_id="ABS24770.1"
FT                   /translation="MTPRAWLIAAAALLSAACAVAPPRAARLPPVSAPSFAMERDERRL
FT                   WKEAAEMDARARKSGAVLGEAPLERYLLGVARRLTPGAALGKLDVRVRVIESPSLSAFV
FT                   SPDGGVFVTMGLLARLENEARLAVVLGHELVHAVNRHAIVEYRTFKHGAALASALPFGL
FT                   GELGTKAAVTGYSRDLEREADEEGLALVAAGGWDVAEATRPFEHLAAWVKEEEIEEPFL
FT                   FSTHPRLEERMESYRTLLATRYAGRSGGDRGRERYQGAIRELVLANARLDLAAGRFGPA
FT                   ERGARAYLALRPKAAEGHALLGDVARQRGGDGAEAGALAHYRKAVELDARCPEAQRGLG
FT                   LALARRNDREGARAALRAYLKLSPDAVDRAWIEGDLAALEGRGP"
     gtgacccccc gcgcctggct gatcgccgcc gcggccctcc tctccgccgc gtgcgccgtc        60
     gcgccgccgc gcgcggcgcg gctgccgccc gtgtccgccc cgagcttcgc gatggagcgc       120
     gacgagcgcc gcctctggaa ggaggccgcc gagatggacg cccgcgcgcg caagagcggc       180
     gccgtgctcg gggaggcccc gctcgagcgc tacctgctcg gcgtcgcccg ccgcctcacg       240
     cccggcgccg cgctgggcaa gctggacgtg cgcgtgcgcg tcatcgagtc gccgagcctg       300
     tccgccttcg tgtcgcccga cggcggggtg ttcgtgacga tggggctgct cgcgcggctg       360
     gagaacgagg cgcggctcgc ggtcgtgctc gggcacgagc tcgtgcacgc cgtgaaccgg       420
     cacgccatcg tcgagtaccg caccttcaag cacggcgccg cgctcgcctc cgccctgccg       480
     ttcggcctgg gcgagctcgg caccaaggcg gcggtcaccg gctactcgcg cgacctcgag       540
     cgcgaggccg acgaggaggg gctcgcgctc gtcgcggcgg gcgggtggga cgtcgcggag       600
     gcgacgcggc ccttcgagca cctcgccgcg tgggtgaagg aggaggagat cgaggagccc       660
     ttcctgttct ccacgcaccc gcgcctcgag gagcggatgg agagctaccg cacgctgctc       720
     gccacccgct acgcgggccg cagcggcggc gaccgcggcc gggagcgcta ccagggcgcg       780
     atccgcgagc tcgtgctcgc caacgcgcgc ctcgatctcg ccgccggacg cttcgggccg       840
     gcggagcgcg gcgcccgcgc gtacctcgcc ctccgcccca aggccgcgga ggggcacgcg       900
     ctcctcgggg acgtggcgcg gcagcgcggc ggcgacggag cggaggccgg cgcgctcgcg       960
     cactaccgca aggccgtcga gctcgacgcg cgctgccccg aggcgcagcg cgggctcggg      1020
     ctcgcgctcg ccaggcgaaa cgatcgcgag ggcgcccggg cggcgctccg cgcgtacctg      1080
     aagctcagcc cggacgccgt ggatcgcgcc tggatcgagg gggacctcgc ggcgctcgag      1140
     gggaggggac catga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page