(data stored in ACNUC7421 zone)

EMBL: CP000769.PE551

CP000769.PE551       Location/Qualifiers
FT   CDS_pept        636846..637415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24771"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7S5"
FT                   /protein_id="ABS24771.1"
FT                   /translation="MRIRLATLACVAALASGCLHDEAPWREVGGKYDSGNWFGPRISMV
FT                   LPDDWMKLNRVEDGLVATRDGFNLQSIKIRRVDPGKPLPHTKKTVAEGMRPHELAEVLL
FT                   DDLRSDGSANGLKVLETRPATIAGAPGFRTTVAFKDAFGLKVKVVLCGVMIEDHAWQIA
FT                   YVAPARHYFEQDLGTFDGALASFRVR"
     atgaggatcc ggctcgcgac gctcgcgtgc gtcgccgcgc tcgcgtcggg gtgcctccac        60
     gacgaggcgc cctggcgcga ggtgggcggc aagtacgact ccggcaactg gttcgggccg       120
     cgcatctcca tggtcctccc cgacgactgg atgaagctca accgcgtcga ggacggcctg       180
     gtcgcgacgc gcgacggctt caacctgcag tcgatcaaga tccggcgggt ggaccccggc       240
     aagccgctgc cgcacacgaa gaagacggtg gcggagggga tgcgcccgca cgagctcgcc       300
     gaggtcctcc tcgacgacct gcgcagcgac ggctcggcga acgggctcaa ggtgctggag       360
     acgcgcccgg cgaccatcgc cggggcgccc gggttccgca cgacggtcgc gttcaaggac       420
     gccttcggcc tcaaggtgaa ggtggtcctg tgcggggtga tgatcgagga tcacgcctgg       480
     cagatcgcct acgtcgcgcc cgcgcggcac tacttcgagc aggacctcgg cacgttcgac       540
     ggggcgctgg cgagcttccg ggtgcggtga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page