(data stored in ACNUC7421 zone)

EMBL: CP000769.PE555

CP000769.PE555       Location/Qualifiers
FT   CDS_pept        640291..641505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0561"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sus:Acid_4926 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24775"
FT                   /db_xref="GOA:A7H7S9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7S9"
FT                   /protein_id="ABS24775.1"
FT                   /translation="MRAVVWKGPGKVAVEKVEDPRIESATDVLVRITTAGICGSDLHMY
FT                   EGRTVAEPGVVLGHENMGVIEEVGSAVQQLQKGDRVVLPFNVACGTCFNCSRGYTSACL
FT                   VTNEEGAGAAYGYVGMGPYRGGQAELLRVPWGEANCIKLPGEPGDELEDDFLLLSDIFP
FT                   TGYHAAEMAKVQPGSTVAIFGAGPVGLLAAYSAMLRGAAEVYVVDAIPERLEKAQQIGA
FT                   IAIDFRQGSPAEQIRDLRLGNPLVRGSMRRGEEKMAGVMCGIDAVGYQAKDFEDPSKEQ
FT                   PTSLTEQLVEIINPTGALGIIGVFLPQDPGGKDRAAKRGAYTLPWGKLWEKGIQLGMGQ
FT                   TPVKNYSLVLRDLVVAGRAKPSFIVSRRIPLSEAPDAYRRFDRREPGYTKVLIKPGEEA
FT                   TAATH"
     atgcgcgcag tggtgtggaa ggggccgggg aaggtcgcgg tggagaaggt cgaggatccg        60
     cgcatcgaga gcgcgaccga cgtgctggtg cgcatcacca ccgccggcat ctgcggcagc       120
     gacctgcaca tgtacgaggg ccgcaccgtc gccgagccgg gggtggtgct cgggcacgag       180
     aacatggggg tcatcgagga ggtgggcagc gcggtgcagc agctgcagaa gggcgatcgc       240
     gtggtcctgc ccttcaacgt cgcctgcggg acctgcttca actgctcgcg cggctacacc       300
     agcgcctgcc tggtgacgaa cgaggagggg gccggggccg cgtacggcta cgtggggatg       360
     gggccgtacc ggggcggaca ggccgagctc ttgcgcgtcc cgtggggcga ggccaactgc       420
     atcaagctgc ccggcgagcc gggcgacgag ctcgaggacg acttcctgct cctctccgac       480
     atcttcccca ccggctacca cgccgccgag atggccaagg tgcagcccgg ctccacggtg       540
     gcgatcttcg gcgccgggcc cgtgggcctg ctcgccgcgt acagcgcgat gctgcggggc       600
     gccgccgagg tgtacgtcgt cgacgccatc cccgagcggc tggagaaggc gcagcagatc       660
     ggggcgatcg ccatcgactt ccggcagggc tcgcccgccg agcagatccg cgacctgcgc       720
     ctcgggaacc cgctcgtgcg cggctcgatg cgccgcggcg aggagaagat ggcgggcgtc       780
     atgtgcggca tcgacgcggt cggctaccag gccaaggact tcgaggatcc gagcaaggag       840
     cagccgacct ccctcaccga gcagctcgtg gagatcatca accccaccgg cgcgctcggc       900
     atcatcggcg tcttcctccc gcaggatccg ggcggcaagg acagggcggc gaagcggggg       960
     gcgtacacgc tgccgtgggg caagctgtgg gagaagggca tccagctcgg catggggcag      1020
     acgccggtga agaactacag cctcgtgctc cgcgatctcg tcgtggccgg ccgggcgaag      1080
     ccgagcttca tcgtctcgcg gcgcatcccg ctcagcgagg cgccggacgc ctaccggcgc      1140
     ttcgaccggc gcgagcccgg gtacacgaag gtcctcatca agccgggcga ggaggcgacg      1200
     gcggcgacgc actga                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page