(data stored in ACNUC7421 zone)

EMBL: CP000769.PE563

CP000769.PE563       Location/Qualifiers
FT   CDS_pept        complement(651135..652280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0569"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   ade:Adeh_0518 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24783"
FT                   /db_xref="GOA:A7H7T7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7T7"
FT                   /protein_id="ABS24783.1"
FT                   /translation="MSTHLSTSLVLGLALLSACGQKSGAKASGGPVEVGVVTLAPTSVT
FT                   LTKELPGRTSAFRVAEVRARVNGIVQKRLFTEGADVKAGQPLFVIDPAQYQASLEGAKA
FT                   QLARAEARVASARMQAQRYTELVAENAVSKQEADDAVAALKAAEADVAAGRAAVQTARI
FT                   NLGYTTVTSPLTGRIGRSAVTEGAYVQQGQATLLATVQQLDPVYVDLTQSSTEALRLRR
FT                   DHAEGKLQRAGQGQAKVQLVLEDGRPYGLDGTLQFADVTVDPSTGSIGLRALFPNPRGE
FT                   LLPGMFVRARLQEGVNPEALLVPQQAVARDQKGQPTALVVNAERKVERRQLVTDRAIGD
FT                   AWLVTSGLSRGEQVIVEGLQKVRPGAEVKPVPVAGPKHAVR"
     atgagcacac acctctcgac ctccctcgta ctcgggctgg cgctcctctc cgcgtgtggc        60
     cagaagtccg gggccaaggc gtccggcggc ccggtggagg tcggcgtcgt gacgctcgcg       120
     cccacgtcgg tgacgctcac gaaggagctg ccgggccgca cgtccgcgtt ccgcgtggcg       180
     gaggtgcggg cccgcgtcaa cgggatcgtc cagaagcggc tcttcaccga gggcgccgac       240
     gtcaaggccg ggcagcccct cttcgtcatc gatcctgcgc agtaccaggc gtcgctggag       300
     ggagcgaagg cgcagctcgc ccgcgccgag gcgagggtcg cgtcggcccg gatgcaggcg       360
     cagcggtaca ccgagctcgt cgccgagaac gcggtgagca agcaggaggc cgacgacgcg       420
     gtggccgcgc tgaaggcggc ggaggcggac gtcgcggccg ggcgcgccgc cgtgcagacc       480
     gcgcggatca acctgggcta caccaccgtc acctctccgc tcaccgggcg catcggccgc       540
     tccgcggtga cggagggcgc ctacgtccag cagggccagg cgacgctgct cgcgaccgtg       600
     cagcagctcg accccgtcta cgtggatctc acgcagtcga gcaccgaggc gctgcggctg       660
     cggcgcgacc acgccgaggg caagctgcag cgcgccggcc aggggcaggc gaaggtgcag       720
     ctcgtgctcg aggacggccg gccctacggg ctggacggga cgctgcagtt cgcggacgtc       780
     acggtcgatc cgagcacggg ctcgatcggg ctgcgcgcgc tgttcccgaa cccgcgcggc       840
     gagctcctgc cgggcatgtt cgtgcgcgcg cggctgcagg agggggtgaa cccggaggcc       900
     ctgctcgtgc cgcagcaggc ggtcgcgcgc gaccagaagg ggcagcccac cgcgctcgtg       960
     gtcaacgcgg agcggaaggt cgagcgccgg cagctcgtca cggatcgcgc catcggcgac      1020
     gcctggctcg tgacctccgg gctctcccgc ggggagcagg tgatcgtgga ggggctgcag      1080
     aaggtccggc ccggcgcgga ggtgaagccc gtcccggtgg ccggcccgaa gcacgccgtc      1140
     cgctga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page