(data stored in ACNUC7421 zone)

EMBL: CP000769.PE570

CP000769.PE570       Location/Qualifiers
FT   CDS_pept        complement(659879..660310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0576"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: gme:Gmet_0230 DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24790"
FT                   /db_xref="GOA:A7H7U4"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7U4"
FT                   /protein_id="ABS24790.1"
FT                   /translation="MDTRALAATAARLETLAYAALRLVAGAMFAFHGAQKILGWLPAGP
FT                   APALGTQLWFGGIIELVGGTLIALGLFTRAAAFLASGTMAVAYTQFHWKLAVANFAWLP
FT                   SVNKGELAALYCFLFLFVMARGPGPASLDAVLRGGARAR"
     atggacaccc gtgcactggc cgcgaccgcg gcgcgcctcg agacccttgc ctatgccgcg        60
     ctgcgcctcg tcgcaggagc gatgttcgcg ttccatggcg cccagaagat cctgggctgg       120
     ctccccgccg gacccgcacc ggcgctcggc acgcagctct ggttcggggg gatcatcgag       180
     ctcgtgggcg ggacgctcat cgcgctcggg ctcttcacgc gcgcggcggc cttcctcgcc       240
     tccgggacga tggccgtcgc gtacacccag ttccactgga agctcgcggt ggcgaacttc       300
     gcgtggctgc cctcggtgaa caagggcgag ctcgcggcgc tgtactgctt cctgttcctg       360
     ttcgtgatgg cgcgaggccc ggggccggcg tcgctcgacg ccgtgctccg cggcggcgcg       420
     cgcgcgcgtt ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page