(data stored in ACNUC7421 zone)

EMBL: CP000769.PE576

CP000769.PE576       Location/Qualifiers
FT   CDS_pept        complement(663837..664646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0582"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   ade:Adeh_3146 Rieske Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24796"
FT                   /db_xref="GOA:A7H7V0"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7V0"
FT                   /protein_id="ABS24796.1"
FT                   /translation="MSLTRRRFLVRTAAGAAGAVAGAALPGCAPDASPAPLVDVPAPVG
FT                   GRLSLLVARYPELAKVGGAVRARAPGLDEPVLIARVTEDGFVAMSSVCTHQGCPVGFDG
FT                   AQVVCPCHQSTFDLQGRVTNPPAVQGLTPYAAFYDPSLGELAVDLVAGDEGFPRWDAGV
FT                   VTLPLAQYPQLGQPGGSVAGRPGGAPRPLALLVVALPDLEYAALDAICTHLGCTVGYDA
FT                   GRALVICPCHDSRYTTDGVVQQGPATRKLQRYDVTADAQAVTVRIPA"
     atgagcctca cgcgccgtcg cttcctggtg aggaccgccg ccggcgccgc cggcgccgtc        60
     gcgggggcgg ccctgcccgg ctgcgcaccc gacgcatcgc cggcgccgct cgtggacgtg       120
     ccggccccgg tcggcggccg cctgagcctc ctcgtcgctc gctacccgga gctggcgaag       180
     gtgggcggtg cggtgcgagc gcgtgcgccg ggcctcgacg agccggtcct catcgctcgc       240
     gtcacggagg acggcttcgt ggcgatgtcg agcgtctgca cgcaccaggg ctgtccggtc       300
     ggattcgacg gcgcgcaggt ggtctgtccc tgtcaccagt ccacgttcga cctgcaaggg       360
     cgggtcacga acccgcccgc ggtccagggc ctcacgcctt acgccgcgtt ctacgacccg       420
     agcctcggcg agctcgcggt ggacctcgtc gccggcgacg aagggttccc gcgctgggac       480
     gccggcgtgg tgacgttgcc gctcgctcag tacccgcagc tcgggcaacc gggaggctcg       540
     gtcgccgggc ggcccggggg agcgccccgg ccgctcgcgc tcctcgtggt cgcgctcccc       600
     gaccttgagt acgcggcgct cgacgcgatc tgcacgcacc tcggctgcac cgtcggctac       660
     gacgcggggc gcgcgctcgt catctgcccg tgccacgact cgcgctacac gacggacggc       720
     gtcgtgcagc aaggtcccgc gactcggaag ctccagcgat acgacgtcac cgccgatgcc       780
     caggcggtga cggtgcgcat cccggcctga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page