(data stored in ACNUC7421 zone)

EMBL: CP000769.PE580

CP000769.PE580       Location/Qualifiers
FT   CDS_pept        complement(666650..667282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0586"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24800"
FT                   /db_xref="GOA:A7H7V4"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7V4"
FT                   /protein_id="ABS24800.1"
FT                   /translation="MRATPRASMVALALALGAGSAGAADDEPRDRKGEEKRPDLSPRAP
FT                   ELDFDLLGKPAKKANPEVQRKLETRRKMLTLHTGIGIATWAALATTTAVGQLDFDDRFR
FT                   GGGDTGKYHGWHTGLAYGTSALFLTTALLGVLAPKPFSEPARLDTALLHKIAMGVATAG
FT                   MITQIVLGVVARGQAGSLSERDLATAHQLVGYSTLGAMTFGMTVLVF"
     atgagagcga ccccccgtgc atcgatggtt gccctggccc tggcgctggg cgccggctcg        60
     gccggtgcgg cagacgacga gcccagggat cggaagggcg aggagaagcg ccccgacctg       120
     tcgccgcggg cccccgagct ggacttcgat ctgctcggca agcctgcgaa gaaggccaac       180
     cccgaggtgc agcggaagct cgagacccgg cgcaagatgc tgacgctgca caccggcatc       240
     gggatcgcca cctgggcggc gctggccacg acgaccgcgg tcgggcagct cgacttcgac       300
     gatcgcttcc gcggcggcgg cgacaccggc aagtaccacg ggtggcacac cggcctcgcc       360
     tacggcacca gcgcgctgtt cctcacgacg gcgctgctcg gcgtgctcgc gccgaagccc       420
     ttctccgagc cggcccggct cgacacggcg ctgctgcaca agatcgccat gggcgtggcc       480
     accgccggca tgatcaccca gatcgtcctc ggcgtcgtcg cgcgcggcca ggccgggagc       540
     ctctccgagc gtgacctcgc gaccgcgcac cagctcgtcg gctactcgac gctgggggcg       600
     atgacgttcg ggatgacggt gctcgtcttc tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page