(data stored in ACNUC7421 zone)

EMBL: CP000769.PE581

CP000769.PE581       Location/Qualifiers
FT   CDS_pept        667518..668396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_1610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24801"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7V5"
FT                   /protein_id="ABS24801.1"
FT                   /translation="MTKRLALASLLLATSALAADPQMKPFVLASRGAGDVEAAASTARQ
FT                   KLQAAGFEIAGSYAPYPGAVVLAVTNETLKAEGAKTGSGGYVAAQRVTITRVGEEVQVA
FT                   FTNPVYMAAAYRLPGDLAPVTASLQGALGRIEEYGPSEGKSAKELRKYHYMVGMEYFDE
FT                   PSKLGHFASHDEAVRAVEAGLAERRGGASKVYRIDLPGGRQTVFGVALTDGCSGDARIM
FT                   KEIDFKPVRSTGHLPYEILVTEGDVRALYARFRIAVNFPDLKMMGSHSFMDIRCAPDAI
FT                   EKALKAVAGAR"
     atgaccaagc gcctcgccct cgccagcctc ctgctcgcca cctctgccct cgccgccgac        60
     ccccagatga agccgttcgt gctcgcctca cgcggtgccg gcgacgtgga ggcggcggcg       120
     agcacggcga ggcagaagct ccaggccgcc gggttcgaga tcgccgggag ctacgcgccg       180
     taccccggcg ccgtggtgct cgcggtgacg aacgagacgc tgaaggccga aggcgcgaag       240
     accgggtccg gcggctacgt cgccgcccag cgcgtcacca tcacgagggt gggcgaggag       300
     gtccaggtcg ccttcaccaa cccggtgtac atggcggcgg cctaccgcct ccccggcgat       360
     ctcgcgccgg tcacggcgtc gctccagggc gcgctgggga ggatcgagga gtacgggccg       420
     tcggagggga agagcgcgaa ggagctccgc aagtaccact acatggtggg catggagtac       480
     ttcgacgagc cgtcgaagct cggccacttc gcgagccacg acgaggcggt cagggcggtc       540
     gaggccgggc tcgcggagcg gcgcggcggc gcgagcaagg tgtaccggat cgatctcccc       600
     ggcgggcggc agacggtgtt cggggtggcg ctcaccgacg gctgctcggg cgacgcgcgc       660
     atcatgaagg agatcgactt caagccggtc cgctccaccg gccacctgcc gtacgagatc       720
     ctcgtcacgg agggtgacgt gcgggcgctc tacgcccgct tccggatcgc ggtgaacttc       780
     ccggacctca agatgatggg ctcgcacagc ttcatggaca tccgctgcgc gcccgacgcg       840
     atcgagaagg cgctgaaggc ggtggccggg gcgcggtga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page